(data stored in ACNUC1104 zone)

EMBL: CP002417.PE333

CP002417.PE333       Location/Qualifiers
FT   CDS_pept        353676..354452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0334"
FT                   /product="putative integral membrane sensor protein"
FT                   /note="PFAM: MHYT domain protein; KEGG: vap:Vapar_0328
FT                   putative integral membrane sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34556"
FT                   /db_xref="GOA:E6V2C5"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C5"
FT                   /inference="protein motif:PFAM:PF03707"
FT                   /protein_id="ADU34556.1"
FT                   /translation="MTPLVVGQLLSPEYSLGLVALSFLISFAGSLVALICAGRMVNADG
FT                   KPNLALVACAAVALGGIGIWSMHFIGMLAYRLPVAISYNMPLTIVSLVAAILISGIALY
FT                   LAGGRRKFSKPGWAAGSLLAGVGVCVMHYMGMFAMNMRATMELDMGTVALSVVIAITAA
FT                   AAALWLAFNLRKLSHQIGAAAVMGVAVCTMHYVGMTAASMICTAAAPTDALAIGGSYMG
FT                   LSVFGTAGAVLIFIYWVATGNSLDAPTPQRARPRTS"
     atgactcccc tcgtcgtagg ccagttgctg tcgcccgagt actcattggg gctggtggcg        60
     ctttcattcc tcatctcgtt cgcgggatcg ctggtggcgc tgatctgcgc gggccgcatg       120
     gtcaacgcgg acggcaaacc caacttggcc ctcgtggcct gcgccgcagt ggcgctcggg       180
     ggcatcggca tctggtcgat gcacttcatc ggcatgctgg cctaccggtt gccggtggcc       240
     atttcgtaca acatgccgct gacgatcgtg tcgctcgtgg cggccatcct gatctccggc       300
     atcgccctct acctggccgg tggccggcgc aagttcagca aacccggctg ggcagccggc       360
     agcctgctgg caggcgtcgg cgtctgcgtg atgcattaca tgggcatgtt cgcgatgaac       420
     atgcgcgcca cgatggagct cgacatgggc accgtcgcgc tatctgtggt gatcgccatc       480
     accgccgccg cggccgcctt gtggctggcc ttcaacctgc gcaagttgag ccaccagatc       540
     ggcgccgctg cggtgatggg cgtggcggtc tgcacgatgc actacgtggg catgaccgcc       600
     gccagcatga tctgcacggc cgcggcgccg accgatgcgc tcgccatcgg cggcagctac       660
     atgggcctgt cggtgttcgg cacggccggt gcggtgctga tcttcatcta ctgggtggcc       720
     accggcaaca gcctcgacgc cccgacgccg cagcgcgccc gcccccgcac cagctag          777
//

If you have problems or comments...

PBIL Back to PBIL home page