(data stored in ACNUC1104 zone)

EMBL: CP002417.PE334

CP002417.PE334       Location/Qualifiers
FT   CDS_pept        354527..356137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0335"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="KEGG: vap:Vapar_0327 methylcrotonoyl-CoA
FT                   carboxylase; PFAM: carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34557"
FT                   /db_xref="GOA:E6V2C6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C6"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADU34557.1"
FT                   /translation="MPVIESRLSSASDTFQANRTGMLALLDQVRAHEARAASASGASAE
FT                   RFAKRGQLLPRERIALLLDTGAPFLPLASLAGLGHDNPDLSKSVPGGGLISGIGQVAGV
FT                   RCMVSASDSGIDAGALQPMGLDKQLRVQEIALENKLPYVQLVESAGANLMQYRVQDFVR
FT                   GGSIFRNLARLSAAGLPVVTVTHGSSTAGGAYQTGLSDYIVMVRDRTRAFLAGPPLLKA
FT                   ATGEIATEEELGGAVMHTHISGLGDYLAEDDRDAIRIARSILGGIDWTRDEAPRAFTPP
FT                   RYDAEDLLGIMPSDGRRPVDMREVIARIADGSEFLEFSEHYGSATVCAHIRLEGHAVGI
FT                   VTNNGPIDSDGATKATHFIQACCQSRTPIVYLQNITGYMVGRAHEEAGIIKHGAKMIQA
FT                   VTNATVPQITLYCGASYGAGNYGMCGRGFAPRFCFSWPNARTAVMGGEQAAKTMAIVME
FT                   AGMARKGAVDTAKIDAMQQQIVERFDRQMSVFTTSAMLLDDGVIDPRDTRAVLAEVLSV
FT                   CRDADARVPQAMQFSVARP"
     atgcccgtca tcgaatcccg gctgtcatcg gccagcgaca ccttccaggc caaccgcacc        60
     ggcatgctcg cgctgctgga ccaggtgcgt gcgcacgagg cccgcgccgc gtctgcctcg       120
     ggcgcctcgg ccgagcgctt tgccaagcgc ggccagctct tgccgcgcga acgcatcgcg       180
     ctgctgctgg acaccggcgc gccctttctt ccgctggctt ctctcgcagg ccttggtcat       240
     gacaaccccg atctttcgaa gagcgtgccc ggcggcgggt tgatctccgg catcggccag       300
     gtcgcgggcg tgcgctgcat ggtgagcgcc tccgattcgg gcatcgacgc cggcgcgctg       360
     caaccgatgg gcctggacaa gcagctgcgc gtgcaagaga tcgcgctcga gaacaagctc       420
     ccctacgtgc agctggtcga aagcgccggc gccaatctca tgcagtaccg cgtccaggac       480
     ttcgtgcgcg gcggcagcat ctttcgcaac ctcgcgcggc tctcggcggc ggggctgccc       540
     gtggtgacgg tgacgcatgg ctcctcgacc gcgggcggcg cctaccagac gggtttgtcg       600
     gactacatcg tgatggtgcg cgatcgcacc cgggccttcc tcgccggacc gccgctgctg       660
     aaagccgcca ccggcgaaat cgccaccgaa gaagaactcg gcggtgccgt gatgcacacc       720
     cacatttcgg gcctgggcga ctacctcgcc gaagacgacc gcgacgccat ccgcatcgca       780
     cgctcgatcc tcggcggcat cgactggacc cgcgacgaag caccgcgcgc cttcacgccg       840
     ccgcgctacg acgccgaaga cctgctgggc atcatgccga gcgacggacg ccggccggtg       900
     gacatgcgcg aggtcatcgc gcgcatcgcc gacggctccg agttcctcga attcagcgag       960
     cactacggca gcgccaccgt ctgcgcccac atccggctcg aaggccatgc ggtgggcatc      1020
     gtcaccaaca acggcccgat cgattccgac ggcgcgacca aggccacgca cttcatccag      1080
     gcctgctgcc agtcgcgcac gcccatcgtc tacctgcaga acatcaccgg ctacatggtg      1140
     ggccgcgcgc acgaggaggc cggcatcatc aagcacggcg ccaagatgat ccaggccgtg      1200
     accaacgcca cggtgccgca gatcacgctg tactgcggcg cctcgtacgg cgcgggcaac      1260
     tacggcatgt gcggccgagg cttcgctccg cgcttctgct tctcgtggcc gaacgcgcgc      1320
     accgccgtga tgggcggcga gcaggccgcc aagaccatgg ccatcgtcat ggaggccggc      1380
     atggcgcgca agggcgcggt cgacaccgcg aagatcgatg cgatgcagca gcagatcgtc      1440
     gagcgcttcg accggcagat gagcgtgttc accaccagcg cgatgctgct ggacgatggc      1500
     gtgatcgatc cgcgcgacac gcgcgcggtg ctggccgagg tgctgtcggt gtgccgcgat      1560
     gccgatgcgc gcgtgccgca ggcgatgcag ttctcggtgg cgcggccatg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page