(data stored in SCRATCH zone)

EMBL: CP002417.PE336

CP002417.PE336       Location/Qualifiers
FT   CDS_pept        358127..359038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0337"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0325 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34559"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34559.1"
FT                   /translation="MNASSRYRSVFSPGLFDGQVIVVTGGGSGIGRCTAHELASLGAQV
FT                   VLVGRNAEKLQQVQKEIATAGGKASTQAFDIRQEEAVRTAIAEVVAAHGRIDGLINNAG
FT                   GQYITPLAAISAKGWEAVIHTNLTGGFLVARECFVQSMQANGGAIVNIVADMWGSMPNM
FT                   GHSGAARAGMVSFTETAALEWAANGVRVNAVAPGYIASSGMDHYPPEAGDMLRAMRKTV
FT                   PAGRFGNEAETSAAIAFLLSPAASFISGSVLRVDGARPQVRMGWPMALPDAAAQQRPAV
FT                   RAFDGFHLAQTPRVFQDKETND"
     atgaacgcct cttcccgcta ccgctccgtg ttctcgcccg gcctgttcga tggacaggtg        60
     atcgtcgtta ccggtggcgg ctcgggcatc ggccgctgca cggcgcacga gctcgcatcg       120
     ctcggcgcgc aggtcgtgct tgtcggccgc aatgccgaga agctgcagca ggtacagaaa       180
     gaaatcgcca ccgccggcgg caaagccagc acccaggcct tcgacatccg gcaagaagaa       240
     gccgtgcgta cggcgattgc cgaggtggtc gcagcacacg gccgcatcga cggcctcatc       300
     aacaacgccg gcggtcagta catcacgccg ctcgccgcca tctcggccaa gggctgggaa       360
     gcggtgatcc acaccaacct caccggcggc ttcctcgtcg cgcgcgaatg cttcgtgcag       420
     agcatgcagg cgaacggcgg cgccatcgtc aacatcgtgg ccgacatgtg gggctcgatg       480
     cccaacatgg gccacagcgg tgccgcgcgc gcgggcatgg tgagcttcac cgaaacggcc       540
     gcgctcgaat gggccgcgaa cggcgtgcgc gtgaacgcgg tggcgccggg ctacatcgca       600
     tcgagcggca tggaccacta cccgcccgag gccggcgaca tgctgcgcgc gatgcgcaag       660
     accgtgcctg ccggccgctt cggcaacgaa gccgagacct ccgcggccat cgccttcctg       720
     ctgagccccg cggcgagctt catcagcggc agcgtgctgc gcgtggacgg cgcgcggccg       780
     caggtgcgca tgggctggcc gatggcgctg ccggatgcag cggcgcagca gcgcccggca       840
     gtgcgggcgt tcgacggctt ccatctggcg cagacgcccc gcgtgttcca ggacaaagaa       900
     acgaacgact ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page