(data stored in ACNUC1104 zone)

EMBL: CP002417.PE338

CP002417.PE338       Location/Qualifiers
FT   CDS_pept        360246..361424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0339"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ctt:CtCNB1_1722 acyl-CoA dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34561"
FT                   /db_xref="GOA:E6V2D0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D0"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34561.1"
FT                   /translation="MDAELQADRAALADTVRRFAENEIAPNVEAWDDAGEFPRALYTRA
FT                   AELGLLGLGYAEAFGGTPASYSLKLPAWIALARHGKSGGVLASLFSHNIGLPPVVLHAS
FT                   DAVRHEVVPAVLRGEKIAALAITEPGGGSDVAALRTTARRESAGDGDHYVLNGEKTFIT
FT                   SGMRAHWITVAVRTGEGRGAGGISMLLVPGDALGLSRKRLTKMGWWCSDTATLHFDNVR
FT                   VPARYLLGDEGAGFRMIMGNFNGERIGLAAGALGFAQACLDEALAWSRERKTFGAALIE
FT                   HQAVRHKLVDMQMRIASTEAWLEAVSAEGDAHEAAGRFNAPEWVAQVCMLKNHATQTMQ
FT                   FCADQAVQILGGMGFMRGTVSERIYREVKVMMIGGGAEEIMKELAARQLGWL"
     atggacgccg aactgcaagc cgaccgcgcg gcgctcgccg acacggtgcg gcgctttgcc        60
     gaaaacgaga tcgcgccgaa tgtcgaagcc tgggacgacg cgggcgaatt tccgcgcgcg       120
     ctctacacgc gcgccgcgga actcgggctg ctcggtctcg gctatgccga agcgttcggc       180
     ggtacgccgg cctcgtattc gctcaagctt cccgcatgga tcgcactcgc gcgccacggc       240
     aagagcggtg gcgtgctcgc gagcctcttc tcgcacaaca tcggcctgcc gccggtggtg       300
     ctgcatgcga gcgacgccgt gcgccacgag gtcgtgcccg ccgtgctgcg cggcgagaag       360
     atcgcggcgc ttgccatcac cgaaccgggc ggcggctccg atgtcgcggc gctgcgcacg       420
     acggccagac gggagagtgc aggcgacggt gatcactatg tgctgaacgg cgagaagacc       480
     ttcatcacgt cgggcatgcg agcccactgg atcacggtcg ccgtacgcac cggagaagga       540
     cgcggtgcag gcggcatctc gatgctgctg gtgcccggag atgcacttgg cctttcgcgc       600
     aagcgcctca cgaagatggg ctggtggtgc tccgacaccg cgacgctgca cttcgacaac       660
     gtgcgcgtgc cggcgcgcta tctgctgggc gacgaaggcg cgggcttccg aatgatcatg       720
     ggcaacttca acggcgaacg catcggcctc gcagccggcg cgctcggctt cgcgcaggcc       780
     tgcctcgacg aagcattggc ttggtcccgc gagcgcaaga ccttcggtgc cgcgctcatc       840
     gagcaccagg cggtgcgcca caagctggtg gacatgcaga tgcgcatcgc ctccaccgaa       900
     gcgtggctcg aggcggtgtc ggcggaaggc gatgcgcacg aagccgccgg ccgcttcaac       960
     gcgcccgaat gggtcgcgca ggtctgcatg ctcaagaacc atgcgacgca gaccatgcag      1020
     ttctgcgccg accaggcggt gcagatcctc ggcggcatgg gcttcatgcg cggcacggtg      1080
     agcgagcgca tctaccgcga agtcaaggtg atgatgatcg gcggtggtgc cgaggagatc      1140
     atgaaggagc tggccgcgcg gcagctcggc tggctgtag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page