(data stored in SCRATCH zone)

EMBL: CP002417.PE340

CP002417.PE340       Location/Qualifiers
FT   CDS_pept        complement(361922..363187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0341"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: vap:Vapar_0322 DEAD/DEAH box helicase domain
FT                   protein; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34563"
FT                   /db_xref="GOA:E6V2D2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D2"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADU34563.1"
FT                   /translation="MPFDSLGLAPALVQAAAESGFAAPTAIQAAAIPPILQGRDVRGSA
FT                   QTGSGKTAAFSLPLLQRLAAEPAQSPRRVRALVLVPTRELAAQVGETMRSLAQHLPERL
FT                   KIAIAFGGVSINPQMMSLRGGADIVVATPGRLLDLVEHNALKLGAVSMLVLDEADRLFD
FT                   LGFAEELGRILALLPAQRQNLLFSATFPPAIQSLADGMLRDPAVIDMQGEPGTEPNIVQ
FT                   RVIEVDANRRTQLLRHLLKENEWERVLVFVATQHSAQIVAEKLYKNGVYAVPFHGDIAQ
FT                   GTRTGILAQFKESRWDVVIATDLAARGIDIAQLPVVINYDLPRSPTDYIHRIGRTGRAG
FT                   ESGLAISFVSASTEAHFRLIEKRQGLLLPRERIEGFEPTEVAVPLVDASGTGGIKGKRP
FT                   SKKDKLRAAAQAAQQGESEKND"
     atgccattcg actcactggg cctggctccc gcgctcgtgc aggctgccgc cgaaagcggt        60
     tttgccgcgc cgaccgccat ccaggccgcg gccatccccc caattttgca gggccgcgac       120
     gtgcggggct cggcgcagac cggctccggc aagaccgccg cattttccct gccgctgctg       180
     cagcgcctgg ccgccgagcc cgcacagtcg ccgcgtcgcg tgcgcgcgct ggtgctcgtg       240
     cccacgcgcg aactcgcggc ccaggtcggc gaaaccatgc gcagccttgc gcagcacctg       300
     cccgagcgcc tgaagatcgc catcgccttc ggcggcgtct cgatcaaccc gcagatgatg       360
     agcctgcgcg gcggcgccga catcgtcgtc gccacgcccg gccggctgct cgacctggtc       420
     gagcacaacg cgctcaagct gggcgcggtc tcgatgctgg tgctcgacga ggccgatcgc       480
     ctcttcgatc tcggctttgc cgaagagctc ggccgcatcc tcgcgctgct gccagcgcaa       540
     cggcagaacc tgcttttctc cgccaccttc ccgcccgcca tccagtcgct ggccgacggc       600
     atgctgcgcg accccgcggt catcgacatg cagggcgagc cgggcaccga gccgaacatc       660
     gtgcagcgcg tgatcgaggt cgatgcgaac cgccgcacgc agctcctgcg ccatctgctc       720
     aaagaaaacg aatgggagcg cgtgctggtg ttcgtcgcca cgcagcattc ggcgcagatc       780
     gttgccgaga agctctacaa gaacggtgtc tacgcggtgc ccttccacgg cgacatcgcg       840
     cagggcacgc gcaccggcat cctcgcgcag ttcaaggaga gccggtggga cgtggtgatc       900
     gctaccgacc tcgcggcgcg cggcatcgac atcgcgcagc tccccgtggt catcaactac       960
     gacctgccgc gctcgcccac cgactacatc caccgcatcg gccgcaccgg ccgcgcgggc      1020
     gagagcgggc tggcgatcag tttcgtgagc gcatcgaccg aggcgcactt tcgcctgatc      1080
     gaaaagcgcc agggcctcct actgccgcgc gagcgcatcg aagggttcga gccgaccgag      1140
     gtggccgtgc cgctcgtcga tgcatcgggc accggcggca tcaagggcaa gcggccgagc      1200
     aagaaggaca agctgcgtgc ggcggcgcag gccgcgcagc agggcgagtc cgaaaagaac      1260
     gactga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page