(data stored in SCRATCH zone)

EMBL: CP002417.PE342

CP002417.PE342       Location/Qualifiers
FT   CDS_pept        363631..363867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34565"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0320"
FT                   /protein_id="ADU34565.1"
FT                   /translation="MNPEDLQRLVTLEMPFGKHKGTLIADLPGNYLTWFAREGFPSGEI
FT                   GRLLHLMHEIDHNGLSDLLKPLRNRPSRRDVSQ"
     atgaaccccg aagacctgca gcgcctcgtg accctcgaaa tgccttttgg caagcacaag        60
     ggcacgctga tcgccgattt gcccggaaat tacctgacct ggttcgcacg cgagggtttt       120
     ccctcgggag aaatcggccg actgctccat ttgatgcatg aaatagacca caacggccta       180
     tcagacctgc tcaaaccgtt gcgaaaccgc ccgtcgcgcc gggatgtttc tcaataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page