(data stored in ACNUC1104 zone)

EMBL: CP002417.PE343

CP002417.PE343       Location/Qualifiers
FT   CDS_pept        364051..364467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0344"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="KEGG: vap:Vapar_0319 RNP-1 like RNA-binding protein;
FT                   PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1 like
FT                   RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34566"
FT                   /db_xref="GOA:E6V2D5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D5"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ADU34566.1"
FT                   /translation="MGKKLYVGNLAYSVRDNDLEQAFGEFGAIVSAKVMMERDTGRSKG
FT                   FGFVEMGSDAEALAAIEAMNGHSLQGRALTVNEARPMEARPPRTGGGGGYGGGAGGGGY
FT                   GGGGGGGGYGGGGGGRSGGGGGGYGGGGGGRGGY"
     atgggcaaga aactctacgt aggcaacctc gcctactctg tgcgtgacaa cgacctggaa        60
     caagctttcg gcgagttcgg cgcaatcgtc agcgccaagg tcatgatgga acgtgacacc       120
     ggccgttcga agggcttcgg ctttgtcgaa atgggttcgg atgctgaagc actcgcagcc       180
     atcgaagcca tgaacggtca ttcgctccag ggccgtgccc tgacggtgaa cgaagcccgt       240
     ccgatggaag ctcgtcctcc ccgcaccggc ggtggtggcg gctacggcgg cggcgctggt       300
     ggcggcggct acggtggtgg tggcggcggc ggcggttacg gcggcggcgg cggtggccgt       360
     agcggcggtg gcggcggcgg ttacggcggc ggcggcggtg gtcgcggcgg ctactaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page