(data stored in ACNUC1104 zone)

EMBL: CP002417.PE345

CP002417.PE345       Location/Qualifiers
FT   CDS_pept        365174..366685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0346"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: vap:Vapar_0317 protein of unknown
FT                   function DUF112 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34568"
FT                   /db_xref="GOA:E6V2D7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D7"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADU34568.1"
FT                   /translation="MDLIHNLSIGFGVAFTFTNLLYCLLGCILGTLIGVLPGIGPVATI
FT                   AMLLPATYALPPVSALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTCIDGYQMARQG
FT                   RAGPALAAAGLGSFFAGCVGTLILAAFAPPLTELAFKFGPAEYFSLMTLGLIGAVVLAS
FT                   GSLLKAVAMIVLGLLLGIVGTDVNSGVARFSFDIPELTDGIGFVVIAMGVFGYGEIIGN
FT                   LSQPDDEREVFTHKVKGLWPTKDDFKRMTPAVLRGTALGSALGILPGGGALLAAFAAYA
FT                   LEKKIKMRPGEVPFGKGNIRGVASPESANNAGAQTSFIPLLTLGIPPNAVMALMVGAMT
FT                   IHNIQPGPQVMTSNPELFWGLIASMWIGNAMLIILNLPLIGMWIKLLTVPYKFLFPAIV
FT                   LFCAIGVYSTNNNTFDVWMVAIFGFIGYLFLKLKTEPAPLLLGFILGPMMEENLRRALL
FT                   LSRGAWSVFVTRPLSAGLLVAAAALLCIVLLPSIKAKREEAFVEE"
     atggacctga tccacaacct ttccatcggt ttcggcgttg ccttcacctt caccaacctg        60
     ctgtattgcc ttttgggctg catcctgggc acgctgatcg gcgtgctgcc gggcatcggc       120
     ccggtcgcga ccatcgcgat gctgctgccc gcgacgtacg cgctgccgcc cgtgtcggcg       180
     ctgatcatgc tggccggcat ctactacggc gcgcagtacg gcggctcgac gacggccatt       240
     ctggtgaacc tgcccgggga gtcgtcctcg gtggtcacct gcatcgacgg ctaccagatg       300
     gcaaggcagg gccgcgcagg ccccgcgctc gcggctgcgg gcctgggctc gttcttcgcg       360
     gggtgcgtcg gcacgctgat cctggctgcc ttcgctccgc cgctgaccga gttggccttc       420
     aagttcggcc cggccgagta cttctcgctg atgacgctgg gcctgatcgg cgccgtggtg       480
     ctggcctcgg gctcgctcct gaaggccgtg gccatgatcg tgctgggcct cttgctcggc       540
     atcgtgggca ccgacgtcaa ctcgggtgtc gcgcgcttca gcttcgacat tcccgagctc       600
     accgacggca tcggcttcgt ggtgatcgcc atgggcgtgt tcggctacgg cgaaatcatc       660
     ggcaacctct cgcagcccga cgacgagcgc gaagtcttca cgcacaaggt caagggcctg       720
     tggcccacca aggacgactt caagcgcatg acgcccgcgg tgctgcgcgg cacggcgctg       780
     ggctcggccc tgggcatcct gcccggcggc ggtgcgttgc tggcggcctt cgcggcctac       840
     gcgctggaga agaagatcaa gatgcgcccc ggcgaagtgc ccttcggcaa gggcaacatc       900
     cgcggcgtgg catcgcccga atcggccaac aacgccggcg cacagacctc cttcatcccg       960
     ctgctgacgc tgggcattcc gcccaacgcg gtgatggcgc tgatggtggg cgcgatgacg      1020
     atccacaaca tccagcccgg cccgcaggtg atgaccagca accccgagct cttctggggc      1080
     ctgatcgcct cgatgtggat cggcaacgcg atgctgatca tcctgaacct gccgctgatc      1140
     ggcatgtgga tcaagctgct gaccgtgccc tacaagttcc tgttccccgc catcgtgctg      1200
     ttctgcgcga tcggcgtgta ctcgaccaac aacaacacct tcgacgtgtg gatggtcgcg      1260
     atcttcgggt tcatcggcta cctgttcctg aagctcaaga ccgagccggc gccgctgctg      1320
     ctgggcttca tcctcgggcc gatgatggaa gaaaacctgc ggcgcgcgct gctgctgtcg      1380
     cgtggtgcgt ggagcgtgtt cgtcacgcgg ccgctgtcgg ccgggctgct ggtggctgcg      1440
     gcggcgctgc tgtgcatcgt gctgctgccg tcgatcaagg cgaagcgcga agaggctttt      1500
     gtcgaggaat ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page