(data stored in ACNUC1104 zone)

EMBL: CP002417.PE347

CP002417.PE347       Location/Qualifiers
FT   CDS_pept        368587..368889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34570"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0314"
FT                   /protein_id="ADU34570.1"
FT                   /translation="MPSMSESERIALAARLHVALRRKHGRVTDTEWMATNAEYAAEIVR
FT                   MTRAHAAETKDEELDQLATRLELAMEPLARAARLAARQPDGTPPTPPPRYVGGLR"
     atgccatcca tgtccgaaag cgaacgcatc gcgcttgcag cccgtcttca cgtggcactg        60
     cggcgaaagc acgggcgcgt gaccgacacc gaatggatgg ccaccaatgc cgagtacgcc       120
     gccgagatcg tgcgcatgac gcgtgcgcac gcggcggaga cgaaggacga ggaactcgac       180
     caactcgcga cgcggctcga gctggcgatg gagccgctgg ctcgagccgc gcggctggcg       240
     gcgcggcagc ccgatgggac gccgcctacg ccgccgcctc gctatgtggg cgggttgcgg       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page