(data stored in SCRATCH zone)

EMBL: CP002417.PE348

CP002417.PE348       Location/Qualifiers
FT   CDS_pept        complement(368952..370079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0349"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0335 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34571"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E0"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34571.1"
FT                   /translation="MVNRRHFSLAVGTAATLASFRIAQAQTEAPLVLGQSAPFTGPAAQ
FT                   LGIQFHQGAKVFLDQYNAQSGRRNVVIKNLDDGYEPDRCAANTQKLIEEDVFALFGYIG
FT                   TPTSLAALPLAVKDKVPFIAPFTGAMSLREPFQKNVFHLRASYNDETALMVKQLTHLGL
FT                   KKIAVFYQNDAYGKAGLDGVTLALSQLDLKPVAMATVERNSADVAQAVKSIVGAKPDAV
FT                   VQVGAYKACAAFIREARKASYGGTFINLSFVGTQALADELGKEAAGVMVTQVVPSPYNP
FT                   ANAITREFVEAVRKAGGGASANFSSMEGYLAAKVLTEGLRKASGKLTRDSLVAGLESID
FT                   RQQFGGFEVSFSAKNHVGSKFVELSMLTGDGRVRT"
     atggtgaatc gcaggcattt ttccttggcc gtgggcaccg ccgccacgct ggccagcttc        60
     aggatcgcgc aggcgcagac tgaagcgccc ctggtgctcg gccagtccgc gcctttcacc       120
     ggtccggccg cgcagttggg tatccagttc catcagggcg ccaaggtgtt cctggaccag       180
     tacaacgccc agtccggccg ccgcaatgtg gtgatcaaga acctggacga cggctacgag       240
     cccgaccgct gcgccgccaa cacgcaaaag ctgatcgagg aggacgtgtt cgccctcttc       300
     ggctacatcg gcaccccgac cagcctggcc gcactgccgc tggcggtgaa ggacaaggtg       360
     ccgttcatcg ccccgttcac cggcgccatg tcgctgcgcg agcccttcca gaagaacgtg       420
     ttccacctgc gcgcctcgta caacgacgag acggcgctga tggtcaaaca gctcacccac       480
     ctgggcctca agaaaatcgc ggtcttctat cagaacgatg cctacggcaa ggccgggctc       540
     gacggggtga cgctggcgct gtcgcagctc gacctgaagc cggtcgcgat ggccacggta       600
     gagcgcaatt cggccgacgt ggcgcaggcc gtgaaatcca tcgtgggcgc aaaacccgat       660
     gcggtggtgc aggtgggcgc gtacaaggcc tgcgcggcat tcatccgcga ggcgcgcaag       720
     gcgagctatg gcggcacctt catcaacctc tcgttcgtcg gaacgcaggc gctggcggac       780
     gagctcggca aggaagccgc gggcgtgatg gtgacgcagg tggtgccctc gccctacaac       840
     ccggccaacg cgatcacgcg cgaattcgtc gaggcggtgc gcaaggccgg cggcggggcc       900
     agcgcgaact tctcgagcat ggagggctac ctggccgcga aggtgctgac cgaggggctg       960
     cgcaaggcct cgggcaagct cacgcgagac agcctcgtcg cggggctgga gagcatcgac      1020
     cggcagcagt tcggcgggtt cgaggtgtcg ttctcggcga agaaccacgt gggatcgaag      1080
     ttcgtcgaac tgtcgatgct gactggcgac gggcgggtgc ggacctag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page