(data stored in ACNUC1104 zone)

EMBL: CP002417.PE349

CP002417.PE349       Location/Qualifiers
FT   CDS_pept        370140..372209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0350"
FT                   /product="molybdopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: vap:Vapar_0336 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34572"
FT                   /db_xref="GOA:E6V2E1"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E1"
FT                   /inference="protein motif:PFAM:PF01568"
FT                   /protein_id="ADU34572.1"
FT                   /translation="MPHATDSLEATTSPAPTTETITVLGACPHDCPDTCALVTTVKDGV
FT                   AVKLQGNAAHSHTGGVLCTKVSRYIERNDHAERLVQPLKRVGPKGSGQFEPVSWDTALD
FT                   DIAAHLRSLRSDPETILPYSYAGTMGLVQGESMDRRFFHKLGASLLDRTICSMAGGEAM
FT                   VHTLGGKVGMRIEFFAEAKLILIWGSNSIASNLHFWRHAQAAKRAGARLVCIDPRKTET
FT                   ADKCDEHIALLPGTDAALALALMHELIVHDWLDHDYIANHTLGWEQLRERALQWPPSRA
FT                   AEVCGIPEAQIVTLAEAYGTTKPAAIRLNYGMQRVRGGGNAARAVACLPALVGAWRGRA
FT                   GGLLLSSSGHFPVDRAALQRPDLLEGRRPRTINMSTIGDALLDAAKPVKAIVVYNSNPV
FT                   AVAPDSAKVVAGFARDDLFTVVLEQFRTDTADYADYLLPATTQLEHWDIHTSYGHTDVL
FT                   LNRPAVAPRGEARSNAWVFRELARRMGFDEPCFSDDDEALCRTAFAENAIDYAQMLTQG
FT                   FTTVKLPEAPFAEGQFPTPSGRCEFFSARLQAMGMDGLPDHVPNWEPAGSSTEFPLAMI
FT                   SPPARNFLNSTFVNVTSLRAIEVEPLLEIHAADAAARGIEDGAMVRVFNQRGEHRCRAE
FT                   VSRRARQGVVHGMGIWWRKFGGDGTNVNQLTSQRLTDIGRGPTFYDCLVQVERA"
     atgccccacg caacggactc cctggaagcc acgacttccc ccgccccgac caccgagacc        60
     atcaccgtgc tgggcgcctg cccccacgat tgccccgaca cctgcgcgct cgtcaccacc       120
     gtcaaggacg gcgtggccgt gaagctgcag ggcaatgccg cccactcgca caccggcggc       180
     gttctgtgca ccaaggtgtc tcgctacatc gaacgcaacg accatgccga gcggctggtg       240
     cagcccctga agcgcgtcgg ccccaagggc agcggccaat tcgagccggt ctcgtgggac       300
     accgcactgg acgacatcgc cgcgcatctt cggtcattgc ggtccgatcc ggaaacaatt       360
     ctcccctact cttatgcggg caccatgggc ctggtgcagg gcgaatccat ggaccggcgc       420
     ttcttccaca agctgggcgc ctcgctgctg gaccgcacga tctgctcgat ggccggcggc       480
     gaggccatgg tccacacgct gggcggcaag gtcggcatgc gaatcgagtt cttcgccgag       540
     gcgaagctga tcctgatctg gggcagcaat tccattgcca gcaacctgca tttctggcgc       600
     cacgcccagg ccgccaagcg cgcgggcgca cggctggtgt gcatcgatcc gcgcaagacc       660
     gaaaccgccg acaagtgcga cgagcacatc gcgcttttgc ccggcaccga cgccgcgctg       720
     gccctggcgc tgatgcacga gctgatcgtg cacgactggc tcgaccacga ctacatcgcc       780
     aaccacacgc tgggctggga gcaactgcgc gagcgcgcac tgcaatggcc gccgtcgcgc       840
     gcggcagagg tctgcggcat tcccgaagcg cagatcgtga cgctggccga ggcctacggc       900
     acgaccaagc ccgccgccat tcgcctgaac tacggcatgc agcgcgtgcg cggtggcggc       960
     aatgcagccc gcgcggttgc ttgcctgccg gcgctggtgg gcgcttggcg cggccgggcg      1020
     ggcgggttgc tgctgagcag ctcgggccat ttcccggtcg accgcgccgc gctgcagcgg      1080
     cccgacctgc tcgaaggccg ccgcccgcgc accatcaaca tgagcaccat cggcgacgcg      1140
     ctgctcgatg cggcgaagcc ggtgaaggcc atcgtggtct acaacagcaa ccccgtcgcg      1200
     gtggcgcccg attcggccaa ggtggtcgcg ggtttcgcgc gcgacgatct cttcaccgtg      1260
     gtgctggagc agttccgcac cgacaccgcc gactacgccg actacctctt gcccgccacc      1320
     acgcagttgg agcactggga catccacacg agctacggcc acaccgacgt gctgctgaac      1380
     cgccccgcgg tcgcgccgcg cggcgaggca cgcagcaacg cctgggtgtt ccgtgaactg      1440
     gcgcgccgca tgggcttcga cgagccctgc ttctcggacg acgacgaagc gctgtgccgc      1500
     accgcgttcg ccgagaacgc gatcgactac gcgcagatgc tgacccaggg cttcaccacc      1560
     gtgaagctgc ccgaggcgcc gttcgccgaa ggccaattcc ccacgccctc gggccgctgc      1620
     gaattcttca gcgcgcgctt gcaggccatg ggcatggacg gccttccgga ccacgtgccc      1680
     aactgggagc cggccggcag ctcgaccgaa ttcccgctcg cgatgatctc gccgcccgcg      1740
     cgcaatttcc tcaactccac cttcgtcaac gtgacgagcc tgcgcgccat cgaggtcgag      1800
     ccgctgctcg aaatccacgc ggccgacgcc gccgcgcgcg gcatcgagga cggcgcgatg      1860
     gtgcgcgtgt tcaaccagcg cggcgagcac cgctgccgcg ccgaggtgtc gcgccgcgcg      1920
     cgccaaggcg tggtgcacgg catgggcatc tggtggcgca agttcggcgg cgacggcacc      1980
     aacgtcaacc agctcacgag ccagcggctg accgacatcg gccgcggccc gacgttctac      2040
     gattgcctgg tgcaggtcga acgcgcgtga                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page