(data stored in ACNUC1104 zone)

EMBL: CP002417.PE350

CP002417.PE350       Location/Qualifiers
FT   CDS_pept        372206..373330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0351"
FT                   /product="aminopeptidase"
FT                   /note="PFAM: aminopeptidase; KEGG: vap:Vapar_0337 putative
FT                   zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34573"
FT                   /db_xref="GOA:E6V2E2"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E2"
FT                   /inference="protein motif:PFAM:PF10023"
FT                   /protein_id="ADU34573.1"
FT                   /translation="MRGLSALALAGALFLTGCADLGYYWQSASGHIGIMRAAKPVPEWL
FT                   ADPATSAPLKAKLELTQRIRRFASAELGLPDNASYKSYADLHRPAAVWNVVAAPPYSLT
FT                   LKNWCFPVAGCVGYRGYYSEDAAKAEAEAQRALDLEVAVYPVPAYSTLGWMNWAGGDPL
FT                   LSTFIGYPEGELARLVFHELAHQVLYVPGDTVFNESYATAVERIGGGMWLQREAGEAAR
FT                   REYAQFDGQRQEFRALALNTRRALTQVYESPEAKAKDWPAVEAMKKAAMADFRARYAEL
FT                   KQGWQGPRQNAYDGWVARANNAAFGAQGAYDDLVPAFEALFDREGRDWPRFYTEVRRIA
FT                   ALPTTEERRSALQTATGILQTHSSEDNNNGEHGA"
     gtgagggggc tgtccgcatt ggcgctggcc ggcgccctgt tcctcacggg ctgcgccgac        60
     ctcggctact actggcagtc cgccagcggt cacatcggca tcatgcgggc cgccaagccc       120
     gtgcccgaat ggctcgcgga cccggccacc tcggcgccac tgaaggccaa gctcgaactc       180
     acccagcgca tccgccgctt cgcctcggcc gaactgggcc tgcccgacaa cgcgagctac       240
     aagtcgtacg ccgacctgca ccgccccgcc gccgtgtgga acgtggtggc cgcgccgccg       300
     tattcgctca cgctcaagaa ctggtgcttt ccggtggccg gctgcgtggg ctaccgcggc       360
     tactacagcg aggatgcagc caaggccgaa gccgaggcgc agcgcgccct cgacctcgaa       420
     gtggccgtgt acccggtgcc cgcgtactcg acgttgggtt ggatgaactg ggccggcggc       480
     gatccgctgc tctccacctt catcggctac cccgagggcg agctcgcgcg cctcgtgttc       540
     cacgagctcg cgcaccaggt gctgtacgtg ccgggcgaca cggtgttcaa cgagtcgtac       600
     gccaccgcgg tcgagcgcat cggcggcggc atgtggctgc agcgcgaagc cggcgaggcg       660
     gcgcgccgcg agtacgcgca gttcgacggc cagcggcaag agttccgcgc gctcgccctc       720
     aacacgcgcc gcgcgctcac gcaggtgtac gagtcacccg aggccaaggc caaggactgg       780
     cccgccgtcg aggcgatgaa gaaggccgcg atggccgact tccgcgcccg ctatgccgag       840
     ctgaagcagg gctggcaggg ccctcgccag aacgcctacg acggctgggt ggcgcgtgcc       900
     aacaatgcgg ccttcggcgc ccagggcgcc tacgacgacc tggtgccggc cttcgaggcg       960
     ctgttcgacc gcgaaggccg cgactggccg cgcttctaca ctgaggtccg gcgcattgcc      1020
     gcgctgccga ccacggaaga acgccggagt gccctgcaga ctgccacggg catcctgcaa      1080
     acccattcca gcgaagacaa caacaacgga gaacacggtg cctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page