(data stored in SCRATCH zone)

EMBL: CP002417.PE351

CP002417.PE351       Location/Qualifiers
FT   CDS_pept        373323..373637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0352"
FT                   /product="polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: polyhydroxyalkanoic acid system protein;
FT                   KEGG: vap:Vapar_0338 polyhydroxyalkanoic acid system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34574"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E3"
FT                   /inference="protein motif:TFAM:TIGR02610"
FT                   /protein_id="ADU34574.1"
FT                   /translation="MPDIHIERNHTLGIAGAREVARQWVQQVEQDYGLECTYTEGKTCD
FT                   VARFSRPGIDGTVEVTADTFKLEATLGFLFSSFSEQIEQKISRNLDALLESPNGGTRFA
FT                   "
     gtgcctgaca tccatatcga gagaaaccac acgctgggca ttgccggcgc ccgcgaagtc        60
     gcgcgccaat gggtgcagca ggtcgagcag gactacggcc tggagtgcac ctacaccgaa       120
     ggcaagacct gcgacgttgc ccggttcagc cgccccggca tcgacggcac ggtcgaggtg       180
     acggccgaca ccttcaagct cgaagcgacg ctgggctttt tgttcagcag tttcagcgag       240
     cagatcgagc agaagatctc gcgcaacctc gacgcgctgc tcgagtcgcc gaacggcggc       300
     acgcgcttcg cgtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page