(data stored in ACNUC1104 zone)

EMBL: CP002417.PE352

CP002417.PE352       Location/Qualifiers
FT   CDS_pept        complement(373843..374580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0353"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0339 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34575"
FT                   /db_xref="GOA:E6V2E4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34575.1"
FT                   /translation="MTTSFDFSRRRALVTGASSGIGRAVALQLAQSGATVTAVGRNAAA
FT                   LDALHAEAGCTPLVIDVSDAAALERALATLPAFDLVVNCAGIALLESALDLQAESFDAV
FT                   MAVNARAAALVASRCGKAMIASGVRGSIVNVSSQASLVALDAHLCYCASKAAMDAITRS
FT                   LCLEFGPHGIRVNSVNPTVTLTPMAAEAWADPAKSAAVLRSIPMGRFAEVGEVVAPILF
FT                   LLSDGASMVSGVALPVDGGYTIV"
     atgacgacct ccttcgactt ctcccgccgg cgcgcgctcg tgaccggcgc cagcagcggc        60
     atcggccgcg cagtagcgtt gcagctcgct caatcgggcg cgacggtgac ggccgtgggg       120
     cgcaacgcgg cggcgctcga tgcgctgcac gcggaggccg gctgcacgcc gctcgtgatc       180
     gacgtgagcg acgccgctgc gttggaacgc gcgctcgcaa cactgccagc gttcgatctc       240
     gttgtgaact gcgccggcat cgcattgctc gaatccgcgc tcgatctgca agccgaaagc       300
     ttcgacgccg tgatggccgt caacgcccgc gccgccgcac tggtcgcctc gcgttgcggc       360
     aaggcgatga tcgcgtccgg cgtgcgcggc agcatcgtca acgtgtcgag ccaagcctcg       420
     ctcgtcgcgc tcgatgcgca tctttgctac tgcgcatcga aggccgcaat ggatgcgatc       480
     acgcgctcgc tgtgcctcga attcggaccg cacggcatcc gcgtgaacag cgtgaatccg       540
     acggtcacgc tcacgccgat ggccgcggag gcctgggccg atccggccaa gagcgcggcg       600
     gtcttgagga gcattccgat gggaaggttt gcagaagtcg gggaggtggt ggcaccgatc       660
     ctcttcctgc tctccgatgg ggcgtcgatg gtcagcggcg tggcgctgcc ggtcgacggg       720
     ggctacacga tcgtctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page