(data stored in SCRATCH zone)

EMBL: CP002417.PE353

CP002417.PE353       Location/Qualifiers
FT   CDS_pept        complement(374577..376103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0354"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: vap:Vapar_0340 xylulokinase; PFAM:
FT                   Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34576"
FT                   /db_xref="GOA:E6V2E5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E5"
FT                   /inference="protein motif:PRIAM:2.7.1.17"
FT                   /protein_id="ADU34576.1"
FT                   /translation="MKYVIGVDIGTQSTKCLLVGIDGKVHAQASVAYQPETPKPLWAQQ
FT                   DCAVWFDAVCESVRACVAKSGVAATDIAAMCVSSLYGGAGIPVDEAMQPLHPCLIWMDR
FT                   RATAEVDAVNANVDVERLQAITGNGVDSYYGYTKILWVREHLPEVWAKTRYFLPPNSYI
FT                   NRRLTGELAVDHSSAGNIGGVYDAARRTWSEEALGMLGIPARMMPPRLVESSDVVGGLS
FT                   AEWAAKLGLAEGMPLMAGGVDAAVATFCAGVTGSGDHVAMIGTSMCWGFVSPTVDARHK
FT                   LITMPHVYRGADRSYVFGGAITAGAAVTWFRETFCQAEVAEAARTGEDAHALIERKAID
FT                   VPAGAEGLVFLPYLMGERSPIWDAQAKGAFIGLSLAHSRAHLYRAVLEGVSFALQHNIE
FT                   AGRQSGQPLDDRLIVVGGAAHSDLWMQIVADITGYPVFTIEEEVEAALGAAMLAALGAG
FT                   LVDAATAERGWVTLVERARPEPAAQAVYRERFEIYKSLYPALRDAMHRLK"
     atgaaatacg tgatcggcgt cgacatcggc acgcagagca ccaagtgcct gctggtcggc        60
     atcgacggca aggtgcatgc gcaggcgagc gtcgcctatc agccggaaac acccaagccg       120
     ctgtgggcgc aacaggactg cgcggtctgg ttcgatgccg tgtgcgagag cgtgcgcgcc       180
     tgcgtggcga agagcggcgt cgcggcaacg gacatcgccg cgatgtgcgt gagcagcctc       240
     tacggcggcg cgggcatccc ggtcgacgaa gccatgcagc cgctgcaccc gtgcctcatc       300
     tggatggacc gacgcgccac cgccgaggtc gatgcggtga acgcgaacgt cgatgtcgag       360
     cggctgcagg cgatcaccgg caacggcgtg gacagctact acggctacac caagatcctg       420
     tgggtgcgcg agcacctgcc cgaggtgtgg gcgaagacgc gctacttctt gccgcccaac       480
     agctacatca accggcggct caccggcgag ctcgcggtgg accacagctc ggccggcaac       540
     atcggcggtg tgtacgacgc ggcgcggcgc acgtggtcgg aggaagcgct cggcatgctg       600
     ggcattccgg cgcgcatgat gccgccgcgc ctcgtcgaat cgagcgatgt ggtcggtggg       660
     ttgagcgccg aatgggccgc gaagctcggc ctcgccgaag gcatgccgct gatggcgggc       720
     ggcgtcgatg cagccgtggc caccttctgc gcgggcgtga ccggcagcgg cgaccacgtc       780
     gcgatgatcg gcaccagcat gtgctggggc ttcgtgagcc cgaccgtcga tgcgcgccac       840
     aagctcatca cgatgccgca cgtgtaccgc ggcgcggacc gcagctatgt gttcggcggc       900
     gcgatcaccg cgggcgccgc cgtcacctgg tttcgcgaaa ccttctgcca ggccgaagtg       960
     gccgaggccg cgcgcactgg cgaagacgcg cacgcgctga tcgagcgcaa ggccatcgac      1020
     gtgccggccg gcgcggaggg cctggtcttc ctgccgtacc tcatgggcga gcgcagccct      1080
     atctgggacg cgcaggccaa gggcgcattc atcggcctct cgctcgcgca cagccgcgcg      1140
     cacctgtacc gcgcggtgct cgaaggcgtg agcttcgcgc tgcagcacaa catcgaagcg      1200
     ggccggcaaa gcgggcagcc gctggacgat cgcctcatcg tggtcggcgg tgccgcgcat      1260
     tcggacctct ggatgcagat cgtcgcggac atcacgggct accccgtgtt caccatcgag      1320
     gaagaggtcg aggcggccct cggtgcggcg atgctcgcgg cgctcggcgc ggggctggtc      1380
     gatgcggcga cggcggagcg cggctgggtc acgctggtgg agcgcgcgcg gcccgagccc      1440
     gcggcgcagg ccgtgtaccg ggagcgcttc gaaatctaca aatctcttta tcccgcgttg      1500
     cgggatgcga tgcatcggct gaaatga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page