(data stored in SCRATCH zone)

EMBL: CP002417.PE356

CP002417.PE356       Location/Qualifiers
FT   CDS_pept        complement(378398..379915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0357"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0343 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34579"
FT                   /db_xref="GOA:E6V2E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34579.1"
FT                   /translation="MTSFAEGEEMLRLEGVSKRFPGVKALSGIDLSIRKGEVHALLGEN
FT                   GAGKSTLMKILGGIYQADEGRIFIEGSERRFAGYNDAIAAGIGIIFQEFSLIPYLNAVE
FT                   NIFLGRYLKNRFGLMDKAGMKRSAERLFDELGVQIDLDVPICRLSVAQQQFVEIGKALS
FT                   LKARLLVLDEPTATLTPNEAGHLFKIMRELRAKGVAMIFISHHLDEIFEVCDRISVLRD
FT                   GANAGHADVGATDVDALVEMMVGRRIEHNFPPKPQPAPRGRKVLEVPEIQLAKGGPVNS
FT                   FTLHEGEILGFAGLVGSGRTELALGMMGADRVHRKTVLRNGKPVRLKDPTEALENGIGL
FT                   LPESRKVEGLITDFTVRFNISMNNLGKHKSAGLVSQKSEKQSAGELAKRVGVKAPSIET
FT                   RVATLSGGNQQKVVIARWLGHASEVLIFDEPTRGIDVGAKAEIYSLMRELTRQGKAIVM
FT                   ISSELPEIVGMCDRVAVFSGGSIVATLEGDSINSGDIMRHATTGGSQ"
     atgacctctt ttgcagaagg cgaagaaatg ctccggctgg aaggcgtgtc caagcgcttt        60
     ccgggcgtga aggcgctctc gggcatcgac ctctcgatcc gcaagggcga ggtgcatgcg       120
     ctgctcggcg agaacggcgc gggcaagtcg acgctgatga agatcctcgg cggcatctac       180
     caggccgacg agggccgcat cttcatcgaa ggcagcgagc gcaggttcgc gggctacaac       240
     gacgcgatcg cggcgggcat cggcatcatc ttccaggagt tcagcctcat cccgtacctg       300
     aacgcggtgg agaacatctt tctcggccgc tacctgaaga accgcttcgg gctgatggac       360
     aaggcgggga tgaagcgctc ggccgagcgg ctcttcgacg agctgggcgt gcagatcgat       420
     ctcgatgtgc cgatctgccg cctctcggtc gcgcagcagc agttcgtgga aatcggcaag       480
     gcgctgtcgc tgaaggcgcg cttgctggtg ctcgacgagc cgaccgccac gctcacaccg       540
     aacgaagccg ggcacctctt caagatcatg cgggagctgc gcgccaaggg cgtggcgatg       600
     atcttcatct cgcaccacct ggacgagatc ttcgaggtgt gcgaccgcat cagcgtgctg       660
     cgcgacggcg ccaacgcggg gcatgcggac gtgggcgcga ccgatgtgga tgcgctggtc       720
     gagatgatgg tcggccgcag gatcgagcac aactttccac cgaagccgca gcccgcgccg       780
     cgcggacgca aggtgctgga agtgcccgaa atccagctcg caaagggcgg tccggtcaac       840
     agcttcacgc tgcacgaagg cgagatcctc ggcttcgcgg ggctcgtggg atcgggccgc       900
     accgaactcg cgctcgggat gatgggcgcc gaccgcgtgc accgcaagac ggtgctgcgc       960
     aacggcaagc ccgtgcgcct gaaggacccg accgaggcgc tggaaaacgg catcggcctc      1020
     ctgcccgaga gccgcaaggt cgaggggctg atcaccgact tcacggtccg cttcaacatc      1080
     tcgatgaaca acctgggcaa gcacaagagc gcgggtctgg tgagccagaa gtccgagaag      1140
     cagtcggccg gcgaattggc caagcgcgtc ggcgtgaagg cacccagcat cgagacgcgt      1200
     gtggccacgc tctcgggcgg caaccagcag aaggtggtga tcgcgcgctg gctcggccac      1260
     gcgagcgagg tgctgatctt cgacgagccc acgcgcggca tcgacgtcgg cgccaaggcc      1320
     gagatctaca gcctgatgcg cgaactcacg cgccagggca aagccatcgt gatgatctcg      1380
     agcgagctgc ccgagatcgt cggcatgtgc gaccgcgtcg ccgtgttctc gggcgggtcc      1440
     atcgtggcca cgctcgaggg cgactccatc aactcgggcg acatcatgcg ccacgcaacc      1500
     acagggggtt cgcaatga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page