(data stored in ACNUC1104 zone)

EMBL: CP002417.PE361

CP002417.PE361       Location/Qualifiers
FT   CDS_pept        383842..384726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0362"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: hse:Hsero_0947 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34584"
FT                   /db_xref="GOA:E6V2F3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F3"
FT                   /inference="similar to AA sequence:KEGG:Hsero_0947"
FT                   /protein_id="ADU34584.1"
FT                   /translation="MKKTSALWCAVLLQLLLLAATSAHGALREEQFDVPVQVSDIYGKR
FT                   VEQSIRVTVFSDDANPVPAPLIVLNHGRAAQSAERAAMGRARYSVASRFFVAQGFVVAV
FT                   PTRIGYGVTGGEDVEASGQCGARRYAPAYEAGLAQTLRVLQVMRARPDVDPARAVIVGQ
FT                   SFGGTIAIAAAAQNPAGVVAAINFAGGGGGNPKTQPQRPCSPEALERLFGHYGKTAHMP
FT                   TLWIYTENDQYFGPTYPQEWFKAFRDAGGKGEFTQFPPYGEDGHALFSRYPEVWQPRVR
FT                   AFLEQVGLMRQRR"
     atgaagaaga catccgcact ctggtgtgcc gtgctgctgc agcttctgct gctggccgcg        60
     acgagcgcgc atggcgcctt gcgcgaggag cagttcgacg tgccggtgca ggtcagcgac       120
     atctacggca agcgcgtcga gcagtccatc cgggtgactg tcttctcgga cgacgcgaac       180
     ccggtgccgg ctccgctgat cgtcctcaac cacgggcggg cggcgcagtc cgcggagcgc       240
     gcggccatgg ggcgcgcgcg ctattcggtg gcgtcgcgct tcttcgtggc gcagggcttc       300
     gtcgtcgctg tgccgacccg catcggctac ggcgtgaccg gcggcgaaga cgtggaggcc       360
     agcggccagt gcggcgccag gcgctacgca ccggcctacg aagcggggct ggcacagacg       420
     ctgcgggtgc tccaggtgat gcgcgcgagg cccgatgtcg atccggcgcg cgccgtcatc       480
     gtcggccagt cgttcggcgg aaccatcgcc atcgcggcgg ccgcccagaa cccggcgggc       540
     gtggtggcgg ccatcaactt cgcgggcggc ggtggcggca atccgaaaac gcagccgcag       600
     cgcccgtgct cgccggaggc gctggagcgg ctgttcggcc actacggcaa gacggcgcac       660
     atgcccacgc tgtggatcta caccgagaac gaccagtact tcgggcccac ctatccgcag       720
     gaatggttca aggccttcag ggatgcgggc ggcaaaggcg agttcacgca gttcccgcct       780
     tacggcgagg acgggcacgc gctgttctcg cgctatcccg aggtgtggca gccgcgggtg       840
     cgggcgttcc tggagcaggt cgggctgatg cgccagcggc ggtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page