(data stored in SCRATCH zone)

EMBL: CP002417.PE362

CP002417.PE362       Location/Qualifiers
FT   CDS_pept        complement(384737..385573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34585"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0348"
FT                   /protein_id="ADU34585.1"
FT                   /translation="MPHPDFKPLSLMSAGPVAANAEPWTPLPYADVPRFDARSVLPHWP
FT                   RLHAGHHLPPPAPDAPLAEGWALYHSGEFERAAAIGLLHGSEGLVLANQATAIYANYLE
FT                   PREATRLAMFRQVIERASAQAAAEPDNCQALYWQAYALGRYSQGISVARALAQGLGTKL
FT                   KGALEHVIALQPAHADAHLALAAFHAEVIDKVGALVGRMTYGVRAETSVELFERGLELH
FT                   PHSPAGMMEYARALLMLHGDSRMAEATQLYEKAAAMTPADARERLDVELARAGLSD"
     atgccccacc ccgatttcaa accgctctcg ctgatgtccg ccggcccggt cgccgcgaac        60
     gcggaaccct ggacgcccct tccctacgcc gacgtgccgc gcttcgatgc gcgcagcgtg       120
     ctgccgcact ggccgcgcct gcacgccggc caccacctgc cgccgcccgc tcccgacgcg       180
     ccgctggcag aaggctgggc gctgtaccac agcggcgaat tcgaacgcgc cgccgccatc       240
     ggccttctgc acggctccga aggcctggtg ctggccaacc aggccaccgc catctacgcc       300
     aactacctcg agccgcgcga ggccacccgg ctcgcgatgt tccgccaggt gatcgagcgc       360
     gccagtgcgc aggccgccgc cgaacccgac aactgccagg cgctctactg gcaggcctat       420
     gcactgggcc gctacagcca gggcatcagc gtggcgcgcg cgctggccca gggcctcggc       480
     accaagctca agggcgcgct ggagcatgtg atcgcgctgc agccggcgca cgccgacgcg       540
     cacctcgcgc tggccgcgtt ccatgccgag gtgatcgaca aggtgggcgc gctggtcggc       600
     cgcatgacct acggcgtgcg cgccgagacc tcggtggagc tgttcgagcg cgggctcgaa       660
     ctgcacccgc actcgcccgc cggaatgatg gaatacgccc gcgccctcct gatgctgcat       720
     ggcgactcgc gcatggccga agccacccag ctctatgaaa aggccgcggc gatgacaccg       780
     gcggatgcgc gggagcggct ggacgtggag ctggctcggg ccggcctgtc ggactga          837
//

If you have problems or comments...

PBIL Back to PBIL home page