(data stored in ACNUC1104 zone)

EMBL: CP002417.PE365

CP002417.PE365       Location/Qualifiers
FT   CDS_pept        complement(386997..387446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0366"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   vap:Vapar_0351 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34588"
FT                   /db_xref="GOA:E6V398"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E6V398"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADU34588.1"
FT                   /translation="MSSITLRFLAEPNTVNFGGKVHGGTVMKWIDEAGYACATSWAKRY
FT                   CVTAFIGSIRFHRPIMIGDLVEVEARLAYTGTTSMNISVEVRSGDMKGGMMEKTTECLI
FT                   VFVSVDSHGRPLPVEAFVPGTPGEMALAERAKAHLDASRAAGATP"
     atgtcctcga tcaccctgcg atttctggcc gaacccaaca ccgtcaactt cggcggcaag        60
     gtccacggcg gcacggtcat gaagtggatc gacgaggcgg gctacgcctg cgcgaccagt       120
     tgggccaagc gctactgcgt caccgccttc atcggcagca tccgctttca ccggccgatc       180
     atgatcggcg acctcgtcga ggtcgaagcc cgcctcgcct acaccggcac caccagcatg       240
     aacatctcgg tcgaggtgcg cagcggcgac atgaagggcg gcatgatgga aaagaccacc       300
     gagtgcctga tcgtcttcgt ctcggtcgat tcgcacggcc ggccgcttcc ggtggaagcc       360
     ttcgtgcccg gcacgcccgg cgaaatggca ctggcggaac gggcgaaggc gcatctcgat       420
     gccagccgcg cagccggcgc cacgccgtag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page