(data stored in SCRATCH zone)

EMBL: CP002417.PE369

CP002417.PE369       Location/Qualifiers
FT   CDS_pept        390565..391818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0370"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0355 salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34592"
FT                   /db_xref="GOA:E6V3A2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A2"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34592.1"
FT                   /translation="MSAFPSETRHPSVLLVGGGIGGMAAALALARLGVSIDLLEQSAAI
FT                   GEIGAGLQLGPNAFAALDALGVGEAVRRGSVFTDRLVMMDAVDCGEVASVPVGEAFRAR
FT                   FRNPYAVSHRADLHGAIHEAVKQHPLIRFHTSAQVESIDSGAHGVTAVTRDGRRFQADA
FT                   IVGCDGVKSVVRAKLIGDAPRVSGHVVYRAVVPAADMPADLRWNAPVVWAGPNCHLVHY
FT                   PLRHGEQYNLVVTFHSREEEEWGVTDGSKEEVLSYFEGVHARPRQLLDRPTSWRRWSTA
FT                   DRDPVDRWSEGPATLLGDAAHPMMQYLAQGACMALEDAVTLGAAVEACDFDMTAAFKLY
FT                   EAARVARTARVVLSVREMGRLYHAKGVERLVRNSLWIGRTPERFYDAVEWLYAWRPEHC
FT                   LDDAPTSLQPAAAEFSLH"
     atgagtgcat tcccctccga aacaagacac ccgtctgtgc tgctcgtcgg cggcggcatc        60
     ggcggcatgg ccgcggcact tgcgctcgcg cgcctcggtg tttccatcga cctgctcgaa       120
     cagagcgcag ccatcggcga gatcggcgcg ggcctgcagc tcggccccaa tgccttcgcc       180
     gcgcttgatg cgctcggcgt gggcgaggcg gtgcgccggg gctcggtctt cacggacagg       240
     ctcgtgatga tggatgcggt cgattgcggc gaggtggcct cggtgccggt cggcgaggct       300
     ttccgcgcgc gcttcaggaa tccgtatgcg gtgagccacc gcgccgacct gcatggcgcg       360
     atccacgaag cggtgaagca gcatccgctg atccgcttcc acacctcggc gcaggtcgaa       420
     tcgatcgata gcggtgcgca cggtgtcacc gcggtcacgc gcgatggccg gcgcttccag       480
     gccgatgcca tcgtgggctg cgacggcgtg aagtcggtgg tgcgcgccaa gctcatcggc       540
     gatgcgccgc gtgtctcggg ccacgtcgtc taccgcgcgg tcgtgcccgc ggccgacatg       600
     ccggccgacc tgcgctggaa cgcgcccgtc gtctgggccg gccccaactg ccacctggtg       660
     cactacccgc tgcgccatgg cgagcaatac aacctggtcg tcaccttcca cagccgcgaa       720
     gaagaggaat ggggcgtcac cgacggcagc aaggaagaag tgctctcgta cttcgagggc       780
     gtgcacgcgc gcccgcgtca gttgctcgac cggcccacct cgtggcgccg ctggagcacc       840
     gccgaccgcg accccgtcga ccgctggagc gaaggcccgg ccacgctgct gggcgatgcg       900
     gcgcatccga tgatgcagta cctcgcgcag ggcgcctgca tggcgctcga agatgcggtg       960
     acgctgggcg cggcggtcga ggcctgcgat ttcgacatga ccgccgcctt caagctgtac      1020
     gaagcggcgc gcgttgcccg cacggcgcgt gtggtgctgt cggtgcgcga gatgggtcgc      1080
     ctgtaccacg cgaagggcgt cgagcggttg gtgcgcaaca gcctctggat cggccgcacg      1140
     ccggagcgtt tctacgatgc ggtcgagtgg ctctatgcgt ggcggccgga gcactgtctg      1200
     gacgatgcac ccacatcgct gcaacctgcc gcggccgagt tttcgttgca ttga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page