(data stored in ACNUC1104 zone)

EMBL: CP002417.PE37

CP002417.PE37        Location/Qualifiers
FT   CDS_pept        complement(40945..41229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0037"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   vap:Vapar_0034 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34260"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADU34260.1"
FT                   /translation="MFSSPTFNSIATILETDFKVDRSAISPATVLTDLGLDSLALMEFV
FT                   FAVEDAFHLRIPEDRLDPREAGITLQRLCEVIDTESSGVVAPAAEVAHA"
     atgttctcct cgcccacctt caacagcatc gcgacgatcc tggagaccga cttcaaggtc        60
     gaccgcagcg ccatctcgcc cgccaccgtg ctgaccgacc tcggcctcga ttcgctcgcg       120
     ctgatggagt tcgtcttcgc ggtggaagac gccttccatc tgcgcattcc cgaggaccgg       180
     ctcgacccgc gcgaagccgg catcacgctg cagcgcctgt gcgaggtgat cgataccgag       240
     agcagcggcg tggttgcacc tgcggctgag gtggcccacg catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page