(data stored in SCRATCH zone)

EMBL: CP002417.PE370

CP002417.PE370       Location/Qualifiers
FT   CDS_pept        391874..392860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34593"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0356"
FT                   /protein_id="ADU34593.1"
FT                   /translation="MNFSRTLLTGGLAFTVTVATTGALAQAGDFPNRPVTLVTPFAAGS
FT                   GPDAVLRLVSDKLSRLWNQRVVIDNKPGGGGFIAIDQARRAAPDGYTLLQLDSEHVAAL
FT                   PHLYKSKNFVTLQHFDPVASLFRTPFFVAVGTDSKWKTMGDLIAAAKAEPEGVVYGSWG
FT                   VGSPGHLGAQQLEALTGIRMRHAPYREVSQLYSNVGTGEVPWAFASIPSSQGIYKAGKL
FT                   RYIAVAAPKRIPQMPDVPTMAEAGGPASLEVNSFVSLLAPKGVPAAVKAKINADVAKVI
FT                   ADPEIRARFDTFAFEPLAWSPEEIQRNAEAKSKVYGELVRRGNISLE"
     atgaatttct cgcgcacatt gctgacgggc ggcctcgcct tcaccgttac cgtcgccacc        60
     accggcgcgc tggcgcaggc cggcgacttc ccgaacaggc ccgtgacgct ggtcacgccc       120
     ttcgccgccg gcagcggccc cgacgcggtg ctgcgcctcg tgtccgacaa gctctcgcgc       180
     ctgtggaacc agcgcgtggt gatcgacaac aagcccggcg gcggcggctt catcgccatc       240
     gaccaggcgc gccgcgccgc gcccgacggc tacacgctgc tgcagctgga cagcgagcac       300
     gtcgccgcgc tgccgcacct ctacaagtcg aagaacttcg tgacgctgca gcacttcgac       360
     ccggtggcct cgctgttccg cacgcctttc ttcgtggccg tgggcaccga ttcgaagtgg       420
     aagaccatgg gcgatctcat cgccgccgcc aaggccgagc ccgaaggcgt ggtgtacggc       480
     tcctggggcg tcgggagccc gggccacctg ggcgcgcagc aactggaggc gctcaccggc       540
     atccgcatgc ggcatgcgcc gtaccgcgag gtgtcgcagc tctattccaa cgtgggcacg       600
     ggcgaggtgc cgtgggcctt cgcgagcatt ccgtcgagcc agggcatcta caaggccggc       660
     aagctgcgct acatcgcggt cgcggcgccc aagcgcattc cgcagatgcc cgacgtgccg       720
     accatggccg aggcgggcgg gccggcctcg ctcgaagtca actccttcgt ctcgctgctc       780
     gcgcccaagg gcgtgccggc ggcggtgaag gcaaagatca acgccgatgt cgccaaggtc       840
     atcgccgacc ccgagatccg tgcgcgcttc gacaccttcg ccttcgagcc gctggcgtgg       900
     tcgcccgagg agatccagcg caacgccgag gccaagtcga aggtgtacgg cgaactggtg       960
     cgcaggggca acatcagcct cgagtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page