(data stored in ACNUC1104 zone)

EMBL: CP002417.PE375

CP002417.PE375       Location/Qualifiers
FT   CDS_pept        397088..397699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0376"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpt:Bpet4536 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34598"
FT                   /db_xref="GOA:E6V3A8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34598.1"
FT                   /translation="MKIFHSPASPFVRKCMVVAHELGIADRIEKLPSAAGPVKRDATIL
FT                   PKNPLGQVPTFLCDDGQVLYDSRVICEYLDAKHSGSLFPADGTQRWARLTELALADGMT
FT                   AAALLARYETMLRPEALRWNDWTEGQLAKVRTGLEWLETAAPSFGDRVDIGTIAFGCTL
FT                   GYMDFRFPSVDWRGEAPNTAKWFEVFNQRASMQATLPAVA"
     atgaagatct tccactcgcc cgcttcgccg ttcgtgcgca agtgcatggt cgtcgcgcac        60
     gagctcggca ttgccgaccg catcgagaaa ctgccgagcg cggccggccc ggtgaagcgc       120
     gacgcgacca tcctcccgaa gaatccgctc ggccaagtcc ctactttcct gtgcgacgac       180
     gggcaggtgc tgtacgacag ccgcgtgatc tgcgaatacc tcgacgcaaa gcattcgggt       240
     tcgctgtttc ccgccgatgg cacgcaacgc tgggcccgtc tcaccgaact ggccctcgcc       300
     gacggtatga cagccgccgc actgctcgcg cgctacgaaa ccatgctgcg ccccgaagcc       360
     ctgcgctgga atgactggac cgagggccag ctcgcgaagg tgcgcaccgg ccttgaatgg       420
     ctcgaaacgg cggcaccgtc gttcggtgat cgcgtcgata tcgggaccat cgccttcggt       480
     tgcacgctgg gctacatgga cttccggttt ccgtcggtcg attggcgcgg cgaggcgccg       540
     aacacggcga agtggttcga ggtgttcaac cagcgggcct cgatgcaggc gacgctgccg       600
     gctgtcgcct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page