(data stored in ACNUC1104 zone)

EMBL: CP002417.PE376

CP002417.PE376       Location/Qualifiers
FT   CDS_pept        397980..399056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0377"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_2845 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34599"
FT                   /db_xref="GOA:E6V3A9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A9"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU34599.1"
FT                   /translation="MNEITRVGVDLAKRVIQVFAVNAAGLRVTGRALARDKFLAWCAQL
FT                   PAGCLVAMEASSSAHYWARKLLALGLDARIIAAPHVVPYRLQGKSGKNDANDAAAICEA
FT                   ASRPHMHFVPIKSVEQQSMLCIHRLREGVKADRTACINRIRGLLAEFGLVFAQSPEALR
FT                   QVLPDAMEDASNELGALARLTLQRAYAQWQELDAHLRWCDERIAAHGKASDQVRQAEQL
FT                   LGVGPVTASAVVATVGDFKQFKNGAQFGAWLGLTPRQNSSGGKNNLGRITKRGDAYLRT
FT                   LLIQGAKSIVLTAHRRDDPISRWVQALRERSGWQKAVVALANKNARILWAVFARGRAFD
FT                   AHHVSTKPPGAIAAVIAV"
     atgaacgaga ttacccgagt cggcgtggat ttggcaaagc gcgtgatcca ggtctttgcg        60
     gtcaatgccg cgggcttgcg cgtcaccggg cgcgccttgg cacgcgataa attcctggct       120
     tggtgcgcgc aactgcccgc gggctgcctg gttgccatgg aggccagctc cagcgcccat       180
     tactgggcgc gcaagctgct tgctctgggg ctggatgccc gcatcattgc cgccccgcac       240
     gtcgtgcctt atcgcctcca aggcaagagc ggcaagaacg acgccaacga tgccgctgcg       300
     atctgcgagg cggcctcgcg cccgcacatg cacttcgtgc cgatcaagag cgtggagcag       360
     caaagcatgc tgtgcattca ccgcctgcga gagggcgtca aggcagaccg caccgcctgc       420
     atcaaccgca tccggggcct gttggcggag ttcggattgg tgttcgccca aagccccgag       480
     gcgctgcgcc aggtgcttcc cgacgcgatg gaagatgcca gcaatgaact gggcgctctg       540
     gcccggttga cgctgcagcg ggcctatgcg caatggcaag aactcgatgc acacctgcga       600
     tggtgcgacg agcgcatcgc tgcacacggc aaggccagcg atcaggtgcg ccaggccgag       660
     cagttgctgg gcgtgggacc ggtcacggca tccgcggtgg tggccacggt gggcgacttc       720
     aagcaattca agaacggtgc gcagttcggc gcctggctgg gtctgacgcc tcgacagaac       780
     tccagcggcg gcaagaacaa cctggggcgc atcaccaagc gaggcgacgc gtacctgcgc       840
     acgctgctga tccagggggc caagtcgatc gtgctgacgg cgcacagacg cgacgacccg       900
     atctcgcgct gggtgcaggc cttgcgcgag cgctccgggt ggcagaaggc cgtggtggcg       960
     ttggccaaca agaacgcgcg catcctgtgg gccgtgttcg cacgcgggcg ggccttcgat      1020
     gcgcaccacg tcagtaccaa accaccaggc gccatcgctg cggtcatcgc ggtgtag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page