(data stored in ACNUC1104 zone)

EMBL: CP002417.PE377

CP002417.PE377       Location/Qualifiers
FT   CDS_pept        399505..400218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0360 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34600"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34600.1"
FT                   /translation="MSSEAQKKVAVVTAGGSGMGAAAARKLAEDGFRVAILSSSGKGEA
FT                   LAQELGGIGVTGSNQSNDDIKRLVDKVTDTWGRVDVLVNSAGHGPRAPILEISDEDWHR
FT                   GMDVYLLSAVRPSRLVAPLMVKQGGGSIINISTFAAFEPDPVFPTSGVFRAGLAAFTKL
FT                   FADQYAAHNVRMNNVLPGFIDSLPEKEVFRERIPMGRYGKSSEIAATIGFLASEGAGYI
FT                   TGQNLRVDGGITRSV"
     atgtcttctg aagcacaaaa gaaagtagcc gtcgtcaccg ccggcggcag cggcatgggc        60
     gccgccgcag cccgcaagct cgcggaggac ggcttccgcg tcgccatcct ctcgtcgtcg       120
     ggcaagggcg aagcgctggc ccaggaactc ggtggcatcg gcgtgaccgg ctcgaatcag       180
     tcgaacgacg acatcaagcg cctggtcgac aaggtgacgg acacatgggg ccgcgtcgac       240
     gtgctggtca acagcgcagg ccacggcccc cgcgcaccga tcctcgagat ctccgacgaa       300
     gactggcacc gcggcatgga cgtctacctg ctgagcgccg tgcgccccag ccgcctcgtg       360
     gcaccgctga tggtgaagca gggcggcggt tcgatcatca acatctccac cttcgcggcc       420
     ttcgagcccg accccgtgtt ccccacttcc ggcgtgttcc gcgccggcct cgcggccttc       480
     accaagctct tcgccgacca atacgccgca cacaacgtgc gcatgaacaa cgtgctgccc       540
     ggcttcatcg acagcctgcc cgagaaggaa gtgttccgcg agcgcatccc gatggggcgc       600
     tacggcaaga gcagcgagat cgctgccacc atcggttttc tcgcttcgga aggcgcgggc       660
     tacatcaccg ggcagaacct gcgcgtggac ggcggcatca cgcgctcggt gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page