(data stored in ACNUC1104 zone)

EMBL: CP002417.PE378

CP002417.PE378       Location/Qualifiers
FT   CDS_pept        400450..401907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0379"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   dac:Daci_0815 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34601"
FT                   /db_xref="GOA:E6V3B1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B1"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADU34601.1"
FT                   /translation="MSSSHSRLRTEWCPSIPRELMAGAVATFALIPEVIAFSFVAGVDP
FT                   AVGLFASFVISLVIAFTGGRPAMVSAAAGSVALVAAPLVHAHGLQYLLAAGVLAGAMQI
FT                   VFGLLRLGVLMRFVSTSVRTGFVNALAILIFAAQMPHFIGANTATWAMVGLGLAVIYLL
FT                   PRITRAVPSPLVCIVVVTLVGHWLDLPLKTVADLGHLPDALPAFAFPSVPFTLDTLRII
FT                   ALPAFAIAMVGLLESMMTASVVDELTDTPSSKNRECSGLGVANVAASFFGGIAGCGMIG
FT                   QTVSNVRYGGRGRLSTLFAGAFLLILMVLLKPWVSQVPVAALVAIMVMVSASTFDWGSL
FT                   RTLVRHPRMSSAVMLATVAVTVATDNLAAGVAVGVLLSGVFFTFKVARLLHVHAEVGEE
FT                   GLRTYRITGQVFFASADMLVDAFDVREIDGAPVHIDVSNAHFWDVTAVAALTKVVERLR
FT                   KHGSVVEVTGLNQASRDLILQLDAAPE"
     atgtcctcct cccacagccg cctgcgcacc gagtggtgcc cgagcattcc gcgcgaactg        60
     atggccggcg cggtcgccac cttcgcgctc attcccgaag tcatcgcttt ctcttttgtc       120
     gcgggtgtcg atccggccgt cgggctgttc gcatcgttcg tgatcagcct cgtcatcgcc       180
     ttcaccggcg gccgcccggc catggtgtcg gccgccgcgg gttcggtcgc gctcgtggcc       240
     gcgccgctgg tgcatgcgca cgggctgcaa tacctgctgg ccgccggcgt gctcgcgggc       300
     gcgatgcaga tcgtgttcgg cctgctgcgc ctgggcgtgc tgatgcgctt cgtctccacc       360
     tcggtgcgca cgggcttcgt caacgcgctc gccatcctga tcttcgcggc gcagatgccg       420
     cacttcatcg gcgctaatac ggccacctgg gcgatggtgg ggctcggcct cgccgtcatc       480
     tacctgctgc cgcgcatcac acgcgccgtg ccttcgccgc tggtgtgcat cgtggtggtg       540
     acgctggtcg gccactggct cgacctgccg ctcaagaccg tggcggacct cgggcacctg       600
     cccgatgcgc tgccggcgtt cgcctttccc tcggtgccgt tcacgctcga cacgctgcgc       660
     atcatcgcgc tgcccgcctt cgccatcgcg atggtcggcc tgctcgaatc gatgatgacc       720
     gcgagcgtgg tggacgagct caccgacacg ccgagctcca agaaccgcga gtgcagcggc       780
     ctgggcgtgg cgaacgtggc agccagtttc ttcggcggca tcgcgggctg cggaatgatc       840
     ggccagacgg tgagcaatgt gcgctacggc gggcgcggcc ggctgtcgac gctgttcgcg       900
     ggcgccttcc tgctgatcct catggtgctg ctcaagccct gggtgtcgca ggtgccggtg       960
     gcggcgctgg tcgcgatcat ggtgatggtg tcggcatcga ccttcgactg ggggtcgctg      1020
     cgcacgctgg tgcgccaccc gcgcatgtcg agcgcggtga tgctcgccac ggtggcggtc      1080
     accgtcgcca ccgacaacct ggccgcgggc gtggccgtcg gcgtgctgct gagcggcgtg      1140
     ttcttcacct tcaaggtggc gcggctgctg cacgtgcatg ccgaagtggg cgaagagggc      1200
     ctgcgcactt accgcatcac ggggcaggtg ttcttcgcgt cggccgacat gctggtggat      1260
     gccttcgacg tgcgcgagat cgacggggcg cccgtgcaca tcgacgtatc gaacgcgcat      1320
     ttctgggacg tgaccgccgt ggccgcgttg acgaaggtgg tcgagcggct gcgcaagcac      1380
     ggcagcgtgg tggaagtgac ggggctcaac caggccagcc gcgacctgat cctgcagctc      1440
     gacgccgcgc ccgagtaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page