(data stored in ACNUC1104 zone)

EMBL: CP002417.PE379

CP002417.PE379       Location/Qualifiers
FT   CDS_pept        402017..402628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0380"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   vap:Vapar_0361 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34602"
FT                   /db_xref="GOA:E6V3B2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B2"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADU34602.1"
FT                   /translation="MEIPAPVLKNMDRTIQSYEDSAREYNAIVAGHRPPEIVDALRRMM
FT                   QLVPAGGTVLEIGSGSGQDADFIESLGGVVRRTDAAQAFLDLQAERGKKGELLNVVTDA
FT                   LGGPYGAILAMAVLIHVDREQVAPVLSKVFDALEPGGVFLAGMRIGEGETNGDYQTVYW
FT                   AKDRFAEALEAAGLRLQWDTEWIGRKDVRWAGFLACRPPE"
     atggaaattc ccgccccggt gttgaagaac atggatcgca ccatccagtc ctacgaggac        60
     tccgcccgtg aatacaacgc gatcgtggcg ggtcaccggc cgcccgagat cgtggacgcg       120
     ctgcgccgga tgatgcagct cgtgcccgct ggcggcacgg tgctggagat cggttccgga       180
     tcggggcagg acgccgactt catcgagtcc ctgggcggcg tcgtccggcg caccgatgcg       240
     gcgcaggcgt tcctcgacct gcaggccgag cgcggcaaga agggcgagct gctcaatgtc       300
     gtgacggatg cgttgggcgg accctacggc gcgatccttg cgatggccgt gctgatccat       360
     gtcgatcgtg agcaggttgc gcccgttctc agcaaagtgt tcgacgcgct cgagcccggc       420
     ggggtcttcc tcgcgggcat gcgcatcggc gaaggcgaga cgaacggcga ctaccagacc       480
     gtctactggg cgaaagaccg gttcgccgaa gcgctcgaag cggccggcct gcgcctgcaa       540
     tgggacacgg agtggatcgg ccgcaaggac gtgcggtggg ctggcttcct cgcgtgccgt       600
     ccgcccgagt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page