(data stored in SCRATCH zone)

EMBL: CP002417.PE38

CP002417.PE38        Location/Qualifiers
FT   CDS_pept        complement(41268..42128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34261"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0035"
FT                   /protein_id="ADU34261.1"
FT                   /translation="MSARDASDELSLVPPEVQRTAVVLLHGLCSTPDELLTVQSALRAR
FT                   GYAAHPLSIDGYSFDANAPMQRAAPYERWLDAIQAQVKALRKQHDRVMLVGISAGSSLA
FT                   LGAAIRCGRDVDALVLMSTTLRFDGWAIPRTQFLLPLAFYTPLGRLWQYRERPPYGVKN
FT                   ERVRAWIERELRHRKISRAGCSVLGVDHLREHDRLIRHVRRNLNAVQCDNVLALHAQQD
FT                   EVASVANLGILARGLRCRAFRTVVVANSYHMITIDNDRQQVVRETVSFADAVAHGTMPA
FT                   HPLYA"
     atgagcgcac gtgacgcctc cgatgagctg agtctggttc cccccgaggt gcaacgcacc        60
     gcggtggtcc tcctgcatgg tttatgcagc acgcctgacg agctgctgac cgtgcaatcg       120
     gcattgcgcg cccgggggta tgcggcccat ccgctgtcga tcgatggcta ctccttcgat       180
     gccaacgcgc caatgcagcg agccgcgccg tacgaacgct ggctcgacgc catccaggcc       240
     caggtgaagg cgctgcgcaa gcagcacgac cgcgtgatgc tggtcggcat ctccgccggc       300
     tcctcgctcg cgctgggcgc ggccatccgc tgcggccgcg atgtcgatgc gctggtgctc       360
     atgtcgacca cgctgcgctt cgacggctgg gcgattccgc gcacgcagtt cctgctgccg       420
     ctcgccttct acacgccgct cgggcgcctc tggcaatacc gcgagcggcc gccctacggt       480
     gtgaagaacg aacgcgtgcg cgcctggatc gagcgcgaac tgcgccaccg caagatctcg       540
     cgcgcgggct gctcggtgct cggcgtggat catctgcgcg aacacgaccg gttgattcgc       600
     catgtgcggc gcaacctgaa cgccgtgcag tgcgacaacg tgctcgcgct gcatgcccag       660
     caggacgagg tggccagcgt ggccaacctg ggcatcctcg cgcgcggcct gcgctgccgc       720
     gcattccgca ccgtggtcgt ggccaacagc taccacatga tcacgatcga caacgaccgc       780
     cagcaggtcg tgcgcgaaac cgtgtcgttc gccgatgcgg tcgcacacgg cacgatgccc       840
     gcgcatcccc tgtacgcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page