(data stored in SCRATCH zone)

EMBL: CP002417.PE382

CP002417.PE382       Location/Qualifiers
FT   CDS_pept        complement(404125..405087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0383"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0364 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34605"
FT                   /db_xref="GOA:E6V3B5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34605.1"
FT                   /translation="MKLSSRSIGLGLVFLLLAAFPLIAPLFGLDFYIGFVRRVLIVALA
FT                   AASLNFILGFGGMVALGHAGFIGMGAYTVVALSDAGVMSAWVMWPLAALVAGLVAALIG
FT                   TVALRTRGVYFIMTTLAFAQMLYFVVVSLRRYGGDDGYTLMSRPTLLPGLDLGNESNFY
FT                   WVVLVIVALALWWLHRATQSRFGHALMGIRDNETRMRALGYPVFRLQLVAFAIAGAIAG
FT                   LAGALLAGGNGFVSPATMHWTQSATLLVMVVIGGLGRSWGGPVGAIVWLLLEEFLKQHT
FT                   EHWHMPLGLLLIAVALWAPKGLAALARRRQAAPLTKATP"
     atgaagctct cctcacgctc catcggcctc gggctggtct ttctgctgct tgcggcgttt        60
     ccgctgatcg cgcccttgtt cgggctcgac ttctacatcg gcttcgtgcg ccgcgtgctc       120
     atcgtggcgc tggccgcggc gagcctcaac ttcatcctcg gcttcggcgg catggtggcg       180
     ctcgggcatg cgggcttcat cggcatgggc gcgtacacgg tggtggcact cagcgatgcg       240
     ggcgtgatgt cggcgtgggt gatgtggccg ctggccgcgc tggtggccgg cctcgtcgcc       300
     gcgctgatcg gcacggtggc gctgcgcacc cgcggcgtct acttcatcat gaccacgctg       360
     gccttcgcgc agatgctgta cttcgtggtg gtgtcgctgc gccgctatgg cggtgacgac       420
     ggctacacgc tcatgagccg cccgacgctc ttgcccggcc tcgatctggg caacgaatcg       480
     aacttctact gggtcgtgct ggtcatcgtg gcgctcgcgc tctggtggct gcaccgcgcg       540
     acgcaatcgc gcttcggcca tgcgctcatg ggcatccgcg acaacgagac gcgcatgcgc       600
     gcgctgggct acccggtgtt ccggctgcag cttgtggcgt tcgcgattgc cggcgccatc       660
     gccgggctcg cgggtgcgct tcttgcaggc ggcaacggct tcgtcagtcc cgcgacgatg       720
     cactggacgc agtcggccac gctgctggtg atggtggtga tcggcggcct cggccgcagc       780
     tggggcggac ccgtgggcgc catcgtctgg ctgctgctcg aggagttcct gaagcagcac       840
     accgagcact ggcacatgcc cctgggcctg ctcctgatcg ccgtcgcgct gtgggcaccc       900
     aagggactgg ccgcactcgc gcgccgccga caggcggcgc cactcaccaa ggcaacacca       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page