(data stored in ACNUC1104 zone)

EMBL: CP002417.PE383

CP002417.PE383       Location/Qualifiers
FT   CDS_pept        complement(405084..406004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0384"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0365 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34606"
FT                   /db_xref="GOA:E6V3B6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34606.1"
FT                   /translation="MSGILVLEQLLNGLGYGLMLFLLAAGLTLVFGIMDVLNLAHGSLF
FT                   MSGAYVAAEAHTRTGSFTAAIVIAVAVTVVVALLLEVLLMRRLYTRDHLAQVLATFGVI
FT                   LVADDIVKMAWGPSPVMSPTPAALSGPVNLMDGLPYPAYRLVILIGGLLVALALYLLVN
FT                   HTRIGMRVRAGASDRPMAELMGVRVGRIFNGVFLLGAALAALAGALMGPIVAVQVGMGE
FT                   AILIPALVVLVIGGIGSVRGAFVAALLVGVVDTIGRAFVPMLLRATLPPATAADLGPLF
FT                   AEVAMYALMVIVLIFRPSGLFSART"
     atgagtggaa ttcttgttct cgagcagctg ctcaacggcc tcggctacgg cctgatgctg        60
     ttcctgctgg ctgcgggcct cacgctggtg ttcggcatca tggacgtgct gaacctcgcg       120
     cacggctcgc tgttcatgtc gggcgcgtac gtggcggccg aggcgcacac gcgcaccggt       180
     tcgttcaccg ccgccatcgt gatcgcggtg gcggtcaccg tggtggtggc gctgctgctc       240
     gaagtgctgc tgatgcgccg cctctacaca cgcgaccacc ttgcgcaggt gctcgccacc       300
     ttcggcgtga tcctggtggc cgacgacatc gtcaagatgg cctggggccc ctcgccagtg       360
     atgtcgccca cgcctgccgc gctctcgggt ccggtgaacc tcatggacgg cctgccctac       420
     ccggcctatc gccttgtgat cctcatcggc gggctcctgg tggcgctcgc gctctacctc       480
     ctggtgaatc acacgcgcat cggcatgcgt gtgcgcgcgg gcgcgtccga ccggccgatg       540
     gctgagctga tgggcgtgcg cgtgggccgc atcttcaacg gcgtgttcct gctcggcgcg       600
     gcactcgccg cactggccgg cgcgctgatg gggccgatcg ttgccgtgca ggtcggcatg       660
     ggcgaagcca tcctgattcc ggccctcgtc gtgctggtga tcggcggcat cggttcagtg       720
     cgcggcgcct tcgtggccgc cctcctggtg ggcgtggtcg acaccatcgg ccgcgcgttc       780
     gtgccgatgc tgttgcgcgc cacgctgccg ccggccaccg cggccgatct cgggccgctc       840
     ttcgccgaag tcgcgatgta cgcgctgatg gtgattgtcc tgatcttccg gccctccgga       900
     ctcttttcgg cgcgcacatg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page