(data stored in SCRATCH zone)

EMBL: CP002417.PE384

CP002417.PE384       Location/Qualifiers
FT   CDS_pept        complement(406134..407339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0385"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0366 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34607"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34607.1"
FT                   /translation="MSHLSPKSPALPRTLVSLLLCGAALGTAASAMAAPVKVGLALDIS
FT                   GPFAALGAEARDGFALGIKQLNGKLGGQDVEFVQADMAGSPDQAKQLVDRMIQRDKIDI
FT                   FSGPIGSNVALAVGPTLFNAKVPYLSANAGPSQFAGAQCNAYFFGTAYQNDQFHEAAGK
FT                   FAQDRGFKKTVLIAPNYPAGKDALGGFKRQFKGQVADELYTKLGQIDYAAELAQLRAAK
FT                   PDSIYFFLPGAMGINFIKQFVGAGLSKDITLVTSGFSADEDVIGAVGEPMLGLFNTSHW
FT                   AHDLDNPANKAFVAAFRKEYNGRYPSVYAAQAYDAILAMDAAVKQSGGNAQNREAVVAA
FT                   LKKANYASTRGAFKYANNHYPIENFYLRVIGKDAQGKVTNKLINTVLTNYGDSYADKCP
FT                   LK"
     atgagccacc tgtccccgaa gtcgcccgcg ctgccgcgca ccctcgtctc gttgctgctc        60
     tgcggcgcag cccttggcac cgcggcgtcg gccatggccg cccccgtgaa ggtgggtttg       120
     gccctcgaca tttcggggcc tttcgcagcg ttgggcgccg aggcgcgcga cggtttcgct       180
     ctcggcatca agcaactgaa cggcaagctc ggcggacagg acgtcgaatt cgtgcaggcc       240
     gacatggccg gcagccccga ccaggccaag cagctggtcg accgcatgat ccagcgcgac       300
     aagatcgaca tcttcagcgg ccccatcggc tccaacgtgg cgctggccgt gggccccacg       360
     ctcttcaacg ccaaggtgcc gtacctctcg gccaacgccg gcccgagcca gttcgcgggt       420
     gcgcaatgca atgcgtattt cttcggcacc gcctaccaga acgaccagtt ccacgaggcc       480
     gccggcaagt tcgcgcagga ccgcggcttc aagaaaacgg tgctcatcgc ccccaactac       540
     cccgccggca aggacgcact gggcggcttc aagcgccagt tcaagggcca ggtggccgac       600
     gagctctaca ccaagctcgg ccagatcgac tacgccgccg aactcgcgca actgcgcgcg       660
     gccaagcccg actcgatcta cttcttcctg cccggcgcga tgggcatcaa cttcatcaag       720
     cagttcgtgg gcgcgggtct gtcgaaagac atcacgctcg tgaccagcgg cttctcggcc       780
     gatgaagatg tgatcggcgc cgtcggcgag ccgatgctcg gcctgttcaa cacctcgcac       840
     tgggcgcacg acctggacaa ccccgccaac aaggcgttcg tggccgcgtt ccgcaaggaa       900
     tacaacggcc gctacccgtc ggtgtacgcg gcgcaggcct atgacgcgat cctcgcgatg       960
     gacgcggccg tgaagcaatc gggcggcaac gcgcagaacc gcgaagcagt ggtcgcagcg      1020
     ctgaagaagg ccaactacgc ctccacgcgc ggcgccttca agtacgcgaa caaccactac      1080
     cccatcgaga acttctacct gcgcgtgatc ggcaaggatg cgcagggcaa ggtcacgaac      1140
     aagctgatca acaccgtgct gaccaactac ggcgacagct acgccgacaa gtgcccgctg      1200
     aagtaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page