(data stored in ACNUC1104 zone)

EMBL: CP002417.PE385

CP002417.PE385       Location/Qualifiers
FT   CDS_pept        complement(407533..407772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0386"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="KEGG: vap:Vapar_0367 ATP synthase F0, C subunit;
FT                   TIGRFAM: ATP synthase F0, C subunit; PFAM: H+transporting
FT                   two-sector ATPase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34608"
FT                   /db_xref="GOA:E6V3B8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B8"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ADU34608.1"
FT                   /translation="MTGFNILPLAVALLIGIAALGSCLGIGLVGQKFLESTARQPEMVD
FT                   VLQTKFFLIAGVTDGAFIIATGIGLWFATANPFG"
     atgaccggct tcaacatcct tcccctcgca gtcgccctgc tgatcggcat cgcagccctc        60
     ggctcgtgcc tgggcatcgg actggtcggc cagaagttcc tcgagagcac cgcgcgccag       120
     cccgagatgg tcgacgtgct gcagaccaag ttcttcctga tcgcgggcgt gaccgacggc       180
     gcattcatca tcgcaaccgg catcggcctc tggtttgcga cggcaaatcc cttcggctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page