(data stored in ACNUC1104 zone)

EMBL: CP002417.PE386

CP002417.PE386       Location/Qualifiers
FT   CDS_pept        complement(407917..412626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0387"
FT                   /product="Ricin B lectin"
FT                   /note="KEGG: vap:Vapar_0368 ricin B lectin; PFAM: Ricin B
FT                   lectin; PKD domain containing protein; Laminin G sub domain
FT                   2; SMART: Ricin B lectin; PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34609"
FT                   /db_xref="GOA:E6V3B9"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B9"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ADU34609.1"
FT                   /translation="MKIRYYVMALMVPFVTLLTHAAITGVSPMTTLSNMATAVSEAVAD
FT                   PLPLQGPGLGNLTYTSAELFKPVSMITSPNHPLDPAHSSAYESREVPATYAGRKDYGMN
FT                   AGIMVNGYFLTSFAPDSGLGPGGFLLYDVSNPRQIQLVKKIYEPEARTKEFRETHSFGT
FT                   AKIGGKTYVVLPSINGVEFWDFTDINDIKQVKKLALPGVNSGDYENVAWQLWWQAPYLY
FT                   VASAGRGMFIVDARDPANAVVANRGAGKPNPVPTGELGGFRLGPIFTMGNHMVLTAMES
FT                   NGGFASLDISDPLNPKVLDSIVGTTPFYYATCFDGRNLHVSTRNSGAKMYSYDLSDRSR
FT                   FVAEDNRLVIDEQLYCATQDNYVIQGAQTRIHKVDVSNPLNHVEVGRGSILREDDPNFS
FT                   HSDNGQVAIFGNLVFVGNDHGSGSGFVVHAVDPDIVKPEVKQVSPANGAKQQALTSRIG
FT                   LGMTDNIRPESVNSNTFIVRPVGGNTLAGTYSVQLGIVNFHPEQPLQPGTSYEVFLPAN
FT                   GLKDYAGNAIGADYRSTFNTGNATDINLMHYWTLAGNLSDQIGNNSGTPASGDAFESIG
FT                   MNFANRTAGVPLKNDGVATVLGGTASLSFYMKTTQAGGANSWTAPGIFGRDQPSGADDV
FT                   FWGWLDSNGRIKLSVGNDGGTASTAAVNDGNWHHVVLTRDAASGAQAVYVDGVKTTSAG
FT                   LTGTKGLANKFSVLGQIQGNTALFKGTLAEVRVYGRVLSDTEVNTLRGQAIIGDPGIGG
FT                   GPKLVNGQLVFNPGTLGSSGAQFRWNFGDGTQTAYSNQPNYTYTYTRPGHFTVTLTVKD
FT                   ANGRETFYTYNLTVIVPTTARAPTHTTNIAGDANSVYSVNPDSGTVAAINSETLAKRWE
FT                   VRVGDEAKTLAVGPDGRIWVTVQGEDKLVALNAADGSVSATVPLAYGSGPYGVAFTPDG
FT                   AKGLLTLESKSVLMSFDPSNGATTGAVALEGNLRGIAVSGDAQVAYVTRFKSKMTGGQL
FT                   HKVNLQSMSAMPTIALPVDTTTVDTESRARGVANYLSQVIISPDGTRAVLPSKKDNIVR
FT                   GKFRDGINLSHDQTVRSILSQVNLQTAAEVFAEQIDFDDRAPARAALYSPSGDYLFVAQ
FT                   MEGNRVAIVDPYSRSVRGEINASSAPHGLYLDAARKRLFVNNFLARSVSVHDVASVLAS
FT                   ETAAPVFLQNVSTVAQEPMAAAALRGKQVFYNASDRRMSKDNYISCASCHADAGDDGMV
FT                   WDFTQRGEGLRRTISLMGRRGLGHGKLHWTANFDEVQDFENDIRNEFGGTGFLSNADFT
FT                   ATQDPLGAPKAGKNAQLDDLAAYLTSLNKYMRSPARNADGSLSVDAARGQALFASAQCV
FT                   TCHTGATFRDGQRHDVGTIQLSSGKGMNQPLAGVGFDTPTLLGTWNTTAFFHNGQAATL
FT                   QDVLAGGHGNASSLPPADVVAIREYVRSQDSDPTPTITRIRSNLSNLCVNIKGVSTTSG
FT                   ATAVQWPCGTASNEKFTVTSLTGGYVQFKAEHSGLCLAQSGTATTNAAVVQLACSAGDT
FT                   TQWSLVGGTIKNRASGSCLDVPNASTAQDTALITWTCNGGTNQSWTQLP"
     atgaagatcc ggtactacgt gatggcattg atggtgccgt tcgtcacact gctgacgcac        60
     gcggcaatca ccggggtcag tccgatgacg accctcagca acatggccac ggcggtctcc       120
     gaagcagtgg ccgacccgct cccgctgcag ggaccgggcc tgggcaatct cacctacacc       180
     tcggcggaac tgttcaagcc ggtgtcgatg atcaccagcc ccaaccaccc gctcgatccg       240
     gcgcacagca gcgcctacga gtcgcgcgag gtgcccgcca cctacgcggg ccgcaaggac       300
     tacggcatga acgccggcat catggtcaac ggctacttcc tcacctcctt cgcgccggac       360
     agcggcctcg gcccgggcgg cttcctgctg tacgacgtgt cgaacccgcg gcagatccag       420
     ctcgtcaaga agatctacga gccggaggcc cgcaccaagg agttccgcga gacgcactcc       480
     ttcggcaccg cgaagatcgg cggcaagacg tatgtggtgc tgcccagcat caacggcgtc       540
     gagttctggg acttcaccga catcaacgac atcaagcagg tgaagaaact cgcgctgccc       600
     ggtgtcaatt ccggcgacta cgagaacgtg gcgtggcagc tctggtggca ggcgccctac       660
     ctgtacgtgg cctcggccgg ccgcggcatg ttcatcgtcg atgcacggga cccggcgaat       720
     gccgtggtcg ccaaccgcgg cgcgggcaag cccaacccgg tgcccaccgg cgaactcggc       780
     ggtttccgcc tcggcccgat cttcacgatg ggcaaccaca tggtgctgac cgcgatggaa       840
     agcaacggcg gtttcgcgag cctggacatc tccgacccgc tcaaccccaa ggtgctcgat       900
     tccatcgtgg gcaccacgcc gttctattac gcgacctgct tcgatggcag gaacctgcac       960
     gtctccacgc gcaacagcgg cgcgaagatg tacagctacg acctctccga ccgatcgcgc      1020
     ttcgtggccg aggacaaccg gctggtcatc gacgagcagc tctattgcgc cacgcaggac      1080
     aactacgtca ttcaaggcgc gcagacgcgc atccacaagg tggacgtgag caatccgctc      1140
     aaccacgtgg aagtgggccg cggcagcatc ctgcgcgagg acgatccgaa cttctcgcac      1200
     tcggacaacg gccaggtcgc gatcttcggc aacctcgtct tcgtgggcaa cgaccacggc      1260
     tcgggcagcg gcttcgtcgt gcatgcggtg gacccggaca tcgtcaagcc ggaagtgaaa      1320
     caggtctcgc ccgccaacgg cgcgaagcag caggcgctga catcgcgcat cggcctgggc      1380
     atgaccgaca acatccgccc cgagagcgtg aactccaaca ccttcatcgt gcgtccggtg      1440
     ggcggcaaca cgctggcggg cacctacagc gtgcagttgg gcatcgtcaa cttccatccc      1500
     gagcagccgc tgcagccggg cacgagctat gaagtgttcc tgccggccaa cggcctgaag      1560
     gactatgcgg gcaacgccat cggcgcggac taccgctcga ccttcaacac cggcaacgcg      1620
     accgacatca acctgatgca ctactggacg ctggcgggca acctctccga ccagatcggc      1680
     aacaacagcg gcacaccggc ctcgggcgac gcgttcgaga gcatcggcat gaacttcgcg      1740
     aaccgcaccg ccggtgtgcc gctgaagaac gacggcgtgg ccaccgtgct cggcggcacc      1800
     gcatcgttga gcttctacat gaagaccacg caggcgggcg gtgcgaactc ctggaccgcg      1860
     cccggcatct tcgggcgcga ccagccgagc ggtgcggacg atgtgttctg gggctggctc      1920
     gacagcaacg ggcgcatcaa gctctcggtc ggcaacgacg gcggcaccgc ctccaccgcg      1980
     gcggtgaacg acggcaactg gcatcacgtg gtgctgacgc gagatgcggc ctcgggcgcg      2040
     caggcggtgt acgtcgacgg cgtgaagacc acctccgcgg gcctcaccgg caccaagggc      2100
     ctcgcgaaca agttcagcgt gctgggccag atccagggca acacggcgct cttcaagggc      2160
     acgctggcgg aggtgcgggt ctacggccgc gtgctgtccg acaccgaggt gaacacgctg      2220
     cgcgggcagg ccatcatcgg cgaccccggc atcggcggcg gaccgaagct ggtcaacggc      2280
     caactggtgt tcaaccccgg cacgttgggg agcagcggcg cgcagttccg ctggaacttc      2340
     ggcgacggca cgcagacggc ctactcgaat cagccgaact acacctacac ctacacgcgc      2400
     cccggccact tcacggtgac gctgacggtg aaggacgcca acggccgcga aaccttctac      2460
     acctacaacc tcaccgtgat cgttccgacc acggcgcggg cgcccacgca caccaccaac      2520
     atcgcgggcg atgcgaactc ggtgtactcg gtcaaccccg acagcggcac ggtcgccgcc      2580
     atcaactccg aaacgctggc caagcgctgg gaagtgcgcg tgggcgacga ggcgaagaca      2640
     ctggcggtcg gccccgacgg ccgcatctgg gtcacggtgc agggcgaaga caagctggtg      2700
     gcgctcaacg cggccgacgg cagcgtctcg gccaccgtgc cgctcgccta cggcagcggc      2760
     ccctatggcg tggccttcac gcccgatggc gccaagggct tgctgacgct ggagagcaag      2820
     tcggtgctga tgagcttcga cccgagcaac ggcgccacca ccggcgcggt cgcgctcgaa      2880
     ggcaacctgc gcggcatcgc cgtgagcggc gatgcgcagg tggcctacgt cacgcgcttc      2940
     aagtcgaaga tgaccggcgg ccagttgcac aaggtgaacc tgcagagcat gagcgcgatg      3000
     cccaccatcg ccctgccggt cgacaccacc acggtcgaca ccgagagccg tgcgcgcggc      3060
     gtcgccaact acctgagcca ggtgatcatt tcgccggacg gcacgcgggc ggtgctgcct      3120
     tcgaagaagg acaacatcgt gcgcggcaag ttcagggacg gtatcaacct gtcgcacgac      3180
     cagacggtgc gttccatcct ctcgcaggtc aacctgcaga cggccgcgga agtgttcgcc      3240
     gaacagatcg acttcgacga ccgggcaccg gcacgcgccg cgctgtactc gccgtcgggc      3300
     gactacctct tcgtcgcgca gatggaaggc aatcgcgtgg cgatcgtcga tccgtacagc      3360
     cgctcggtgc gaggcgaaat caacgccagc agcgcgccgc atggcctgta cctggacgcg      3420
     gcgaggaagc gcctgttcgt caacaacttc ctcgcgcgct cggtgtcggt gcacgacgtg      3480
     gcctcggtgc tggcttcgga gaccgcggcg ccggtcttcc tgcagaacgt ctcgacggtc      3540
     gcgcaggagc cgatggcggc cgctgcgctg cgcggcaagc aggtgttcta caacgcgtcg      3600
     gaccggcgca tgagcaagga caactacatc tcctgcgcga gctgccatgc ggatgccggc      3660
     gacgacggca tggtgtggga cttcacccag cgcggagagg gcctgcgccg caccatcagc      3720
     ctgatgggac ggcgcggtct cggccacggc aagctgcact ggacggccaa cttcgacgag      3780
     gtgcaggact tcgagaacga catccgcaac gagttcggcg gcaccggctt cctctcgaac      3840
     gcggacttca cagccacgca agacccgctg ggtgccccca aggccggcaa gaacgcgcag      3900
     ctggacgatc tcgcggccta cctcacctcg ctgaacaagt acatgcgcag cccggcgcgc      3960
     aacgcagacg gcagcctcag cgtcgacgcg gcgcggggcc aggcgctgtt cgcctcggcg      4020
     cagtgcgtga cctgccacac cggcgccacc ttccgcgacg gacagcggca cgacgtgggc      4080
     accatccagc tctcgtcggg caagggcatg aaccagccgc tggcgggcgt gggcttcgac      4140
     acgccgacgc tcttgggcac ctggaacacg acggccttct tccacaacgg acaggccgcg      4200
     acgctgcagg acgtgctcgc cggcggtcac ggcaacgcca gcagcctgcc gcccgccgac      4260
     gtggtggcga ttcgcgagta cgtgcgatcg caggacagcg acccgacgcc gacgatcacg      4320
     cgcatccgct cgaacctgag caacctgtgc gtgaacatca agggcgtgtc gacgaccagc      4380
     ggcgcgacgg cggtgcagtg gccgtgcggc actgcgagca acgagaagtt cacggtgacg      4440
     agcctcacgg gcggctacgt gcagttcaag gccgaacaca gcggcctgtg cctggcacag      4500
     agcggcaccg cgacgacgaa cgcggcggtg gtgcagctgg cctgctcggc cggcgacacg      4560
     acgcagtgga gcctggtggg cggcacgatc aagaaccgcg cctcgggttc gtgcctcgac      4620
     gttccgaacg cctcgacggc gcaggacacg gcgttgatca cctggacctg caacggcggc      4680
     accaaccaga gctggactca actgccctga                                       4710
//

If you have problems or comments...

PBIL Back to PBIL home page