(data stored in ACNUC1104 zone)

EMBL: CP002417.PE387

CP002417.PE387       Location/Qualifiers
FT   CDS_pept        complement(412855..413715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0388"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   vap:Vapar_0369 deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34610"
FT                   /db_xref="GOA:E6V3C0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C0"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ADU34610.1"
FT                   /translation="MSKDKTARLNRLLTNGRCLDIALDHGVCNEPSFLDGLEDMPQVID
FT                   KLVAAGPDALQLNYGQSDLLQDRPGRDKPALVMRIDMGNPYNATLHRVMWAQLQNEHDP
FT                   VLPAVQRDAACVVVNLFMLPNEPDLFRQCVQNIARVRADCDRYGMPLMIEPLVMQSPTP
FT                   GSRYMVDGDAEKIVTLVRLAREMGADIVKADPTSDPKDFHRVVQAARCPVLVRGGGRED
FT                   LSQVFARSRTLLDQGAVGMVYGRNVYQHGNPSAVVSALMAMIHRDASAEAALDIYESGG
FT                   TKQGK"
     atgtcgaaag acaagacagc acggctcaac cgcctgctca ccaacggccg ctgcctggac        60
     atcgccctcg atcacggcgt gtgcaacgag ccctcattcc tagacggcct ggaggacatg       120
     ccccaggtca tcgacaagct cgtggccgcc ggccccgatg cgctgcaact caactacggc       180
     cagtccgacc tgctgcagga ccgccccggc cgcgacaagc ccgcgctggt gatgcgcatc       240
     gacatgggca acccctacaa cgccacgctg caccgcgtga tgtgggcgca attgcagaac       300
     gagcacgacc cggtgttgcc ggcggtgcag cgcgacgcgg cctgcgtggt ggtcaacctc       360
     ttcatgctgc cgaacgaacc cgacctgttc cgccagtgcg tgcagaacat cgcgcgcgtt       420
     cgcgccgatt gcgaccgcta cggcatgccg ctgatgatcg agccgctggt gatgcagtcg       480
     cccacgcccg gcagccgtta catggtcgat ggcgatgccg aaaagatcgt gacgctggtg       540
     cgcctcgcgc gcgagatggg cgccgacatc gtcaaggccg acccgaccag cgatccgaag       600
     gatttccacc gcgtggtgca ggccgcgcgc tgccccgtgc ttgtgcgcgg cggcggacgc       660
     gaagacctgt cgcaggtgtt cgcgcgctcg cgcacgctgc tggaccaggg cgcggtcggc       720
     atggtgtacg gacgcaatgt ctatcagcac ggcaatccgt ccgcggtggt cagcgcactg       780
     atggccatga tccatcgcga tgccagcgcc gaggcggcct tggacatcta cgaatccggc       840
     ggcacgaagc aaggcaagta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page