(data stored in ACNUC1104 zone)

EMBL: CP002417.PE389

CP002417.PE389       Location/Qualifiers
FT   CDS_pept        complement(414748..415704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0390"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0371 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34612"
FT                   /db_xref="GOA:E6V3C2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34612.1"
FT                   /translation="MKPANKLTSMREAGLLLIIAVLCIAMSFASPYFLTWDNVRAMLLS
FT                   FSIEGIVVVGMTILLIVGGIDLSVGSVVCFAMVVTGKLFLMGVDPWLASLVAIGMCGLI
FT                   GAMIGGCVTRIGLNHFIASLAFMVIVRGLCLALTQGTPQSLFSLPAEFKFIGQGTLFGV
FT                   PAVILIFLAIVVVSDFVLRRSTLLRRVFYTGSNEKAALYSGIRVGRVKFWVTVLCSASA
FT                   GLAGVIYTARFGAATPTFGMGMELNVIAAAVIGGASLKGGSGTVLGAVLGLALLSVVTS
FT                   SLILLDVSPYWQDVIKGLILLAAVTIDHIMNTRKKTR"
     gtgaaacccg ccaacaaact cacgagcatg cgagaagcag ggctgcttct gatcattgcg        60
     gtgctctgca tcgcgatgag cttcgcatcg ccctacttcc tcacctggga caacgtgcgc       120
     gcgatgctgt tgtccttctc catcgaaggc atcgtggtgg tgggcatgac gatcctcctg       180
     atcgtcggcg gcatcgacct ctcggtgggc tcggtggtgt gcttcgcgat ggtggtgacg       240
     ggcaagctct tcctgatggg cgtggacccg tggctcgcga gcctggtggc catcggcatg       300
     tgcgggctca tcggcgcgat gatcggcggc tgcgtcacgc gcatcggcct caatcacttc       360
     atcgcctcgc tggccttcat ggtgatcgtg cgggggctgt gtctcgcgct cacgcagggc       420
     acgccgcagt cgctgttctc gctgccggcg gagttcaagt tcatcggcca aggcacgctc       480
     ttcggtgtgc cggcggtcat cctgatcttc ctggcgatcg tggtggtgag cgacttcgtg       540
     ctgcgccgct cgacgctcct gcgccgcgtg ttctacacgg gcagcaacga gaaggcggcg       600
     ctctattcgg gcattcgcgt gggccgtgtg aagttctggg tcacggtgct gtgctcggct       660
     tcggcgggcc tggccggcgt gatctacacc gcgcgcttcg gcgccgccac gccgaccttc       720
     ggcatgggca tggaactgaa cgtgatcgcg gctgccgtga tcggcggcgc cagcctcaag       780
     ggtggctcgg gcacggtgct gggcgccgtc ctcggcctgg cgctcctctc ggtggtgacc       840
     agctcgctga tcctgctgga cgtgtcgcct tactggcagg acgtgatcaa gggcttgatc       900
     ctgctcgcgg ccgtgaccat cgaccacatc atgaacacca gaaagaagac ccgatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page