(data stored in ACNUC1104 zone)

EMBL: CP002417.PE390

CP002417.PE390       Location/Qualifiers
FT   CDS_pept        complement(415779..417299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0391"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0372 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34613"
FT                   /db_xref="GOA:E6V3C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34613.1"
FT                   /translation="MSALLELKGISKRFGASRALSGVDFSLHAGEIHALCGENGAGKST
FT                   LMNIIDGIHRPDEGEILLNGQKVVIDGPAHAMRLGIGLVHQEIALCADATVAENIFMPE
FT                   INAGKAAWMNYASFNERAAKVLRRLGQDIDPATPVGDLSISSQQLVEIAKALTLDCKVL
FT                   ILDEPTAALTDNESAALFRVLHDLKAQGIGIIYISHRMAEIFTHCDRVTVLRDGRNVHC
FT                   GPLAGSTPDELVRRMVGRDLGNYYPPKQSASPTAESSGPVLEVNDIADGERVHGVSFAL
FT                   KRGEILGIAGLMGAGRSELAETICGLRIAKRGAVRLNGKTLTIRKYSDALRAGIAYLSE
FT                   DRKAAGVFLDLPIAQNVSSMALSRVSSAWGLLQRSAEHKLAKTLGAKLNLKSDGVAIEV
FT                   SSLSGGNQQKVAIAKLLATNPSVLLMDEPTRGVDVGAKSEIHHILRELANQGVGVIVIS
FT                   SELPEIIGLCDRALVIRDGQVAGELEANEMTEEALLRLASGLCEQETA"
     gtgagcgcct tgctcgaact gaaggggatc agcaagcgct tcggcgcttc gcgcgcgctc        60
     tcgggcgtgg acttctcgct gcatgcgggc gagatccacg ccctgtgcgg cgagaacggc       120
     gcggggaagt cgacgttgat gaacatcatc gacggcatcc accgccccga cgagggagag       180
     atcctgctga acggccagaa ggtcgtgatc gacggccctg cgcacgcgat gcgcctgggc       240
     atcggcctgg tgcaccagga gatcgcgctg tgcgcagacg caaccgtcgc cgagaacatc       300
     ttcatgccgg aaatcaacgc cggcaaagcg gcgtggatga actacgccag cttcaacgaa       360
     cgcgcggcca aggtgctgcg ccggctgggg caggacatcg accccgccac gccggtgggc       420
     gacctcagca tctccagcca gcaactggtg gagatcgcaa aggccctcac gctcgactgc       480
     aaggtgctga tcctggacga gcccacggcc gcgctgaccg acaacgagtc ggcggcgctg       540
     ttccgcgtgc tgcacgacct gaaggcgcag ggcatcggca tcatctacat cagccatcgc       600
     atggcggaaa tcttcacgca ctgcgaccgc gtcaccgtgc tgcgcgacgg gcgcaatgtg       660
     cactgcggac cgctggccgg atcgacgccc gatgagctgg tgcgccgcat ggtcgggcgc       720
     gatctcggca actactatcc gccgaagcaa tccgcgtccc caaccgccga atcctccggc       780
     cccgtgctcg aagtgaacga cattgcagat ggcgagcgcg tgcacggcgt ctcgtttgcg       840
     ctgaagcgcg gcgagatcct cggcatcgcg ggcctcatgg gcgccggccg cagcgaactc       900
     gccgaaacca tctgcggcct gcgcatcgcc aagcgcggcg cagtacgttt gaacggcaag       960
     acgctcacca tccgcaagta cagcgacgcg ctgcgcgcag gcatcgccta cctcagcgaa      1020
     gaccgcaagg cggccggtgt gttcctcgac ctgccgatcg cgcagaacgt ctcgtcgatg      1080
     gcactcagcc gcgtgagctc ggcctggggc ctcttgcagc gctcggccga acacaagctc      1140
     gcgaagacgc tcggcgccaa gctgaacctg aaatccgacg gcgtcgccat cgaggtctcc      1200
     agcctctcgg gcggcaacca gcagaaggtg gccatcgcca agctcttggc caccaacccc      1260
     tcggtgctgc tgatggacga gcccacgcgc ggcgtcgacg tgggtgcgaa gtcggagatc      1320
     caccacatcc tgcgcgagct cgcgaaccag ggcgtgggcg tgatcgtgat ctcgtcggag      1380
     ctgcccgaga tcatcggcct ctgcgaccgc gctctcgtga tccgcgacgg ccaggtcgcg      1440
     ggcgaacttg aagctaacga aatgacggaa gaagccctgc tgcggctggc ttccggactc      1500
     tgcgaacagg aaacagcatg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page