(data stored in ACNUC1104 zone)

EMBL: CP002417.PE391

CP002417.PE391       Location/Qualifiers
FT   CDS_pept        complement(417296..418342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0392"
FT                   /product="sugar ABC transporter"
FT                   /note="KEGG: vap:Vapar_0373 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34614"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0373"
FT                   /protein_id="ADU34614.1"
FT                   /translation="MRRNFLKSAAAAGIGLAGASAFAQQQAAAPAAGTGLRGNASDVYV
FT                   MNVMVSGVEYWFPVYEMMKQLGRTLGVKTRYTGTPEYDVNKQLASFEQELARKPAGILL
FT                   HPMNPDPFIEPINRAAAMGIPVVTFAADSPNSKRTSFVTSDNDREGTQAADAIAASLNG
FT                   KGEYAVLENPGQDNHDRRIAAFVNRMKTKHTGMKLVGRAASNQDPNKAYQAVLSLAQAN
FT                   PNLGALFMPEANSALGAAQAKVETKKNIKVMCCDVNAKILDMIKSGDVFGAINPNQGMQ
FT                   GYMGMMMLFLAKNPSLIDPMNDAKRNGTNPMAVPFLDNGLAVVSKANADDFYWDKYLAR
FT                   RGTKGIGE"
     atgaggcgta atttcctgaa gtccgcagcc gccgccggta tcggcctggc cggtgcgagc        60
     gcgttcgcgc aacagcaagc agctgcccct gctgcaggca ccggcctgcg cggcaatgcc       120
     agcgacgtct acgtgatgaa cgtgatggtc tccggcgtgg agtactggtt cccggtctac       180
     gaaatgatga agcagctcgg ccgcacgctg ggcgtgaaga cgcgctacac cggcaccccg       240
     gagtacgacg tgaacaagca gctcgcgtcg ttcgagcagg aactggcgcg caagcccgcg       300
     ggcatcctgc tgcacccgat gaaccccgat ccgttcatcg agccgatcaa ccgcgccgcg       360
     gcgatgggca tcccggtcgt caccttcgcg gccgattcgc cgaattcgaa gcgcacctcg       420
     ttcgtcacct cggacaacga ccgcgaaggc acgcaggcgg ccgacgcgat tgccgcctcg       480
     ctcaacggca agggcgaata cgccgtgctg gagaacccgg gccaggacaa ccacgaccgc       540
     cgcatcgccg ccttcgtgaa ccgcatgaag accaagcaca cgggcatgaa gctggtcggc       600
     cgcgccgcca gcaaccagga cccgaacaag gcctaccaag ccgtgctgag tcttgcgcaa       660
     gccaacccga acctgggcgc gctcttcatg cccgaggcca actcggcgct cggcgcggcg       720
     caggccaagg tcgagaccaa gaagaacatc aaggtgatgt gctgcgacgt caacgccaag       780
     atcctggaca tgatcaagtc cggcgacgtg ttcggcgcca tcaacccgaa ccagggcatg       840
     cagggctaca tgggcatgat gatgttgttc ctggccaaga acccctcgct catcgacccg       900
     atgaacgacg ccaagcgcaa cggcacgaac ccgatggccg tgcccttcct ggacaacggc       960
     ctggccgtgg tgagcaaggc caacgccgac gacttctact gggacaagta cctcgcgcgc      1020
     cgcggcacca agggaatcgg cgagtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page