(data stored in ACNUC1104 zone)

EMBL: CP002417.PE392

CP002417.PE392       Location/Qualifiers
FT   CDS_pept        418522..420069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0393"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   vap:Vapar_0374 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34615"
FT                   /db_xref="GOA:E6V3C5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C5"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADU34615.1"
FT                   /translation="MMPNILIGVDMGSSSLKALALEVGSGRAVALSRMPLPHDRLAGGG
FT                   CEVGAAAIRAALTHVLRDVAHQLGPRAAEVRAMACTGHGAGLYALDANNELVGGRAVAS
FT                   TDQRADARARTLAKSQGARLFEDVGCGPWPGQPTVIAAELLGADAVQRGELRRLLFAKD
FT                   YLGFLLTGEIATDASDASTAGLVSLATGGWSQIAFDASGLTDLGAHNFGPILPSGTVLG
FT                   KLRASEAALCGLPAGIPVAMGAIDLLASMTAICAERRGRAVQVFGTWCVNAVIGPVMEP
FT                   KPAVASIVNFGRTHERLYMENSPSSMANIAWLAGVLALPDARAVVDLAMTVPLGANGLR
FT                   FAPFINGGGGVTAGFVGMKSHHTRADMARAVVDAVAALHVRQTARLAAGGLAVSASTVL
FT                   GGGASDARLVRLLASFLGRPVERCADDETGARGAALYAAMSQGMDDAAEGSALLAPCDL
FT                   IEPDARDARAHADFNADFNELIDSMSPVFTHIAGGAQSAARPPEGARTAARSAEVSP"
     atgatgccaa acatactgat cggcgtggac atgggctcga gcagcctgaa agccctggcc        60
     ctcgaagtcg gaagcggccg agccgttgcc ctgtcccgca tgcctttgcc gcacgaccgg       120
     ctcgccggcg gcggctgcga agtcggcgcc gccgccattc gcgccgcgct cacccacgtg       180
     ctgcgcgacg tggcccacca gctcgggccg cgcgccgcag aggttcgcgc catggcctgc       240
     accggccacg gcgccggcct ctacgcgctc gatgcgaaca acgaactggt cggcggccgc       300
     gccgtcgcat ccaccgacca gcgcgccgat gcccgcgcac ggacattggc caaaagccag       360
     ggcgcgcggc tcttcgaaga cgtgggctgc ggcccctggc ccggccagcc gacggtgatt       420
     gccgccgagc tcctgggcgc agatgccgtg cagcgcggcg aactgcgccg cttgctgttc       480
     gccaaggact acctcggctt cctgctcacc ggcgaaatcg ccacagacgc cagcgatgcg       540
     agcaccgccg gcctggtgtc gctcgccacc ggcggctggt cgcagatcgc cttcgacgcc       600
     tcgggcctca cggacctggg cgcgcacaac ttcggcccga tcctgccgag cggcacggtg       660
     ctcggcaagc tgcgcgcctc cgaggctgcg ctgtgcggcc tgcctgcagg cattcccgtt       720
     gcgatgggcg ccatcgacct gctcgcttcg atgaccgcca tctgcgccga acgccgcggc       780
     cgcgcagttc aggtgttcgg cacgtggtgc gtgaacgccg tcatcggccc ggtcatggag       840
     cccaagccgg cggtcgcctc catcgtgaat ttcggccgca cgcatgagcg gctctacatg       900
     gagaacagcc cgtcttcgat ggccaacatc gcgtggctcg cgggcgtgct cgcgctgccc       960
     gatgcgcgcg ctgtggtcga cctcgcgatg accgtgccgc tcggcgccaa cggcctgcgc      1020
     ttcgcgcctt tcatcaatgg cggcggtggc gtgacggcgg gcttcgtggg catgaagagc      1080
     catcacaccc gcgccgacat ggcacgcgcc gtggtcgatg ccgtggcggc gctgcatgtg      1140
     cgccagacgg cgcgcctggc ggccggcggc ctcgccgtgt ccgcatcgac cgtgctgggc      1200
     ggcggtgcga gcgatgcacg cctcgtgcgc ctgctcgcct cgttcctggg ccgcccggtc      1260
     gagcgctgcg ccgacgacga gaccggcgcg cgcggcgcgg cgctttacgc cgccatgtcg      1320
     cagggcatgg acgacgcggc cgagggcagc gcgctgctcg cgccgtgcga cctcatcgaa      1380
     cccgatgcac gggacgcacg cgcccatgcg gatttcaacg ccgatttcaa cgaactgatc      1440
     gacagcatgt cacctgtatt cacccacatc gcgggcggtg cgcagagcgc cgcacggccg      1500
     cccgaaggcg ctcgcaccgc agcgcgcagc gcggaggttt ctccatga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page