(data stored in ACNUC1104 zone)

EMBL: CP002417.PE393

CP002417.PE393       Location/Qualifiers
FT   CDS_pept        420066..421826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0394"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="KEGG: vap:Vapar_0375 FAD dependent oxidoreductase;
FT                   PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34616"
FT                   /db_xref="GOA:E6V3C6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C6"
FT                   /inference="protein motif:PRIAM:1.1.5.3"
FT                   /protein_id="ADU34616.1"
FT                   /translation="MSAWQLPFVRPASLADRHFSTVIVGAGINGVGVFRDLSLQRVDCL
FT                   IVDKGDFGAGASSAPSRMIHGGLRYLENGSFSLVAEATRERNLLLRNAPHLVRPLKTVV
FT                   PLANFFGGLMSSALKFFGRTPPQRTRGLLAVALGLRLYDILGRRQRVMPGHRISRVPTN
FT                   DRGLFRAAIRWTATFFDAWISHPEWLILELIGDACRDQPRSAAANYCRVMGCAGNILTL
FT                   RDELTGALVRVTADTVVNATGAWLDRSAAVLGGAGPRVMGTKGSHLVLDHPALRDALDG
FT                   RMAYFEAVDGRVCIVYPFLDRVLVGSTDIPVEDPDQIVTEPAEVDYLIDVLREVFPNMA
FT                   FGRDHVVYTYVGVRPLARSDADKPGQISRDHSVVVDPPSATRDIPIVGLVGGKWTTFRS
FT                   LAEEATTEVLQLLGRSRTASTELLPIGGGADLPADAAATERFIEKMTASGMGRARALTL
FT                   LARYGSKALPLAQRLAASGDVPLQHAPDYSAAELSYLCLETGVVHLDDLVIRRTLLAIR
FT                   GLVTDAALAEISGIAAEALGWDAARAHKELRTCATALREHHNVRLQAVAPDVEPSFDAS
FT                   LMASSALGQS"
     atgagcgctt ggcaacttcc cttcgtgcgt cctgcctctt tggcggaccg tcatttttcg        60
     accgtgatcg tcggtgccgg catcaacggc gtcggcgtgt tccgcgatct ctcgctgcag       120
     cgcgtcgatt gcctgatcgt cgacaagggc gacttcggcg ccggtgccag cagcgcaccc       180
     tcgcgcatga tccacggcgg cctgcgctac ctggagaacg gcagcttctc gctggtggcc       240
     gaggccacgc gcgagcgcaa cctgctgctg cgcaacgcgc cgcacctcgt gcgcccgctc       300
     aagaccgtgg tgccgctcgc gaacttcttc ggcggcctca tgagcagcgc gctcaagttc       360
     ttcggccgca cgccgccgca gcgcacgcgc ggcctgctgg cggtggcgct gggcctgcgg       420
     ctctacgaca tcctcggccg ccgccagcgc gtgatgccgg ggcaccgcat cagccgcgtg       480
     ccgaccaacg accgcggcct cttccgcgcg gcgatccgct ggaccgcgac cttcttcgat       540
     gcgtggatca gccatcccga atggctcatt ctcgaactca tcggcgatgc ctgccgcgac       600
     cagccgcgct cggccgccgc caactactgc cgcgtgatgg ggtgtgcggg caacatcctc       660
     acgctgcgcg acgaactcac cggcgcactc gtgcgcgtga ccgccgacac cgtggtgaac       720
     gccacgggcg cgtggctgga ccgcagcgcg gccgtgctcg gcggcgcagg cccgcgcgtg       780
     atgggcacca agggctcgca cctcgtgctc gaccaccccg cgctgcgcga tgcgctcgac       840
     ggccgcatgg cgtatttcga ggcggtggac gggcgcgtgt gcatcgtcta tcccttcctc       900
     gaccgcgtgc tcgtgggctc gaccgacatc ccggtcgaag acccggacca gatcgtcacc       960
     gaacccgccg aggtcgacta cctcatcgac gtgctgcgcg aggtgttccc caacatggcc      1020
     ttcgggcgtg accacgtggt ctacacctat gtcggcgtgc ggccgctcgc gcgctccgat      1080
     gccgacaagc cgggccagat ctcgcgcgac cactcggtgg tggtcgatcc gccgagcgcg      1140
     acgcgcgaca ttcccatcgt tggcctcgtc ggcggcaagt ggacgacctt ccgttcgctc      1200
     gccgaggaag cgaccaccga agtgctgcag cttctggggc gctcgcgcac cgcatcgacc      1260
     gagctgctgc ccatcggcgg tggtgcagac ctgccggccg atgcggccgc gaccgagcgt      1320
     ttcatcgaga agatgacggc ctcgggcatg ggccgcgcgc gcgcactgac gctgctcgcg      1380
     cgctacggct cgaaggcact gccgctcgcg cagcgcctcg ccgcctcggg cgacgtgccg      1440
     ttgcaacacg cacccgacta ctcggccgcc gagctctcgt acctgtgcct ggaaaccggc      1500
     gtggtgcatc tcgatgacct cgtgatccgc cgcacgctgc tggcgattcg cggcctcgtc      1560
     accgatgccg cgttggccga aatctcgggc atcgcggccg aggcgctggg ctgggacgcg      1620
     gcgcgcgcgc acaaggagct gcgcacctgc gcgacggccc tgcgcgagca tcacaacgtg      1680
     cgcctgcagg ccgtggcgcc cgacgtggaa ccttctttcg atgcatcatt gatggccagc      1740
     tccgccctcg gccagtccta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page