(data stored in ACNUC1104 zone)

EMBL: CP002417.PE394

CP002417.PE394       Location/Qualifiers
FT   CDS_pept        421829..422590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0395"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vap:Vapar_0376 transcriptional regulator, GntR
FT                   family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34617"
FT                   /db_xref="GOA:E6V3C7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADU34617.1"
FT                   /translation="MNSPNDTLSTVLDRNSESPLWAQFRDAIRLQILKGVLPIGAKLPS
FT                   EAELGDQFGISRIVVREALADLVRNNLIYKIKGRGAFVSARERDEDFVSTVLGFSDEME
FT                   RKGRSVRTQILTQELRAPTEQEAASLGLTEPDAQVVALKRLRSVDGELRLLVETVVPAD
FT                   LTPGLHRTRLDDRSLYDVLRRQYGLRLVRAERWIDAVLPDAETCKLLDLPHPEPLLRIE
FT                   SIAYGANGRPLEHYRALHRCKTSRLHVQTTT"
     gtgaacagtc ccaacgacac cctgtcgacc gtgctcgacc gcaactccga gtccccgctg        60
     tgggcccagt tccgcgatgc gatccgcctg cagatcctga agggcgtgct gcccatcggc       120
     gccaagctgc catccgaagc cgagctgggc gaccagttcg gcatctcgcg catcgtggtg       180
     cgcgaggccc tggccgacct ggtgcgcaac aacctcatct acaagatcaa gggccgcggc       240
     gcttttgtgt cggcgcggga gcgcgacgag gatttcgtct ccacggtgct cggcttctcc       300
     gacgaaatgg agcgcaaggg ccgctcggtg cgcacgcaga tcctcacgca ggaactgcgc       360
     gcgcccaccg agcaggaagc cgcatcgctg gggctcaccg agcccgatgc gcaggtcgtt       420
     gcgctcaagc gtcttcgcag tgtcgatggc gagctgcgcc tcctggtcga gacggtggtg       480
     cccgcagacc tcacgccggg gctgcatcgc acgcggctgg acgaccgttc gctctacgac       540
     gtgctgcgtc gccagtacgg cctgcgcctg gtgcgcgccg agcgctggat cgatgcggtg       600
     ctgcccgatg ccgaaacctg caagctgctg gacctgccgc accccgagcc gctgttgcgc       660
     atcgagtcga tcgcctatgg cgcgaacggc cggccgctgg agcactaccg cgcgctgcac       720
     cgctgcaaga cgagccgcct gcacgtgcag acgacgacct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page