(data stored in SCRATCH zone)

EMBL: CP002417.PE398

CP002417.PE398       Location/Qualifiers
FT   CDS_pept        427491..429479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0399"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="KEGG: vap:Vapar_0380 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34621"
FT                   /db_xref="GOA:E6V3D1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34621.1"
FT                   /translation="MNVPMVRELRAWFFEGLSKYRAAPLWANVVLVVSLALLALMIVFF
FT                   GGSSAAPGVPATRITHADWQVTEAPGFREPSIVMDSRALPDTWQSIELPLSLPIALLRQ
FT                   TDDRFIASATRTTWLRVAVHDLPVTTGPLALYGVRIKTDGTIAVYADGRLVHRDQENGP
FT                   LWNSTRTPLWVVIEKTPDAVPLKEILIRLEHTRNAQVAVSSLWLGPVDSLKDRYNKRLW
FT                   FQQDLPAMLGAAFMAVGLFALFVWFRRRHETGYLLFFNLATTSFLRSLHFYVSLPVAND
FT                   WFAWLTVNSLFWLVAVVHFALRQLHGRPLQWLTYAVVGWTALIGVLTLPGLGILTNTPQ
FT                   VTPLIYVGAAAMGAAVALVGGISAWRRSNEGRLVAVGIGVCVLLGLSDWLLQNNFANPE
FT                   GWYLGSYTNAVTFAVFGTLMYRRYVNAIAEVELVNASLAERLQAREAELEQSHRRLREV
FT                   EKRQTISDERQRLMQDMHDGLGSSLISAIRSVENGRLSDEKVSHILRSCLDDLKLTIDS
FT                   MEPLEEDLLLLLATLRYRLGPRLEGSGVALRWEVQEIPPLDWLDPTSALHILRIVQESI
FT                   ANILRHTRATEIRVGTAPEAEGVRVTIEDNGQGFDVDKAMAEAGGRGMQNQLRRAQAIG
FT                   GGVSWRSGPTGTLFTLWLPLQRKPRKA"
     atgaacgtcc ccatggtgcg cgagctgcgc gcgtggttct tcgaaggcct ctcgaaatac        60
     cgcgccgcgc ccctctgggc gaatgtggtg ctggtcgtct ccctcgccct cctggcgctc       120
     atgatcgtct tcttcggcgg ttcctccgcc gcgccaggcg tgccggcgac ccggatcacc       180
     catgccgact ggcaggtcac cgaagcgccg ggctttcgcg aaccctcgat cgtcatggac       240
     agccgggcct tgccagacac ctggcagtcc atcgagctgc ccctgtccct gcccatcgcg       300
     ctgctgcgcc agaccgacga ccgcttcatc gccagcgcaa cgcgcaccac gtggcttcgc       360
     gtggccgtgc acgacctgcc cgtcaccacg ggcccgctcg cgctgtacgg cgtgcgcatc       420
     aagaccgacg gcaccatcgc ggtgtacgcc gacggccggc tggttcaccg cgaccaggaa       480
     aacggaccgc tgtggaacag cacccgcacg ccgctgtggg tggtgatcga gaaaacgccc       540
     gatgccgtac cgctgaagga aatcctcatc cgcctggagc acacgcgcaa tgcgcaggtg       600
     gcggtgtctt cgctttggct gggcccggtc gattcgctga aggaccgcta caacaagcgc       660
     ctgtggttcc agcaggacct gcccgccatg ctcggcgcgg ccttcatggc ggtgggcctg       720
     ttcgcactgt tcgtgtggtt ccggcgccgg cacgagaccg gctacctgct tttcttcaat       780
     ctcgcgacca cgtcgttcct gcgaagtctg catttctacg tgagcctgcc ggtggccaac       840
     gactggttcg cctggctcac ggtcaactcg ctgttctggc tggtcgcggt ggtgcacttt       900
     gcgctgcgcc aattgcatgg ccgaccgctc cagtggctca cgtacgcggt ggtcggctgg       960
     actgcgctga tcggcgtgct gaccctgccg ggcctcggca tcctgacgaa caccccgcag      1020
     gtcacgccgc tcatctacgt cggcgcggcc gccatgggcg cggccgtggc gctggtggga      1080
     ggcatcagcg cctggcgccg ctcgaacgaa ggccggctgg tggccgtcgg catcggcgtg      1140
     tgcgtgctgc tgggcctgtc cgactggctg ctgcagaaca acttcgcgaa tccggagggc      1200
     tggtacctgg ggtcctacac caacgccgtg accttcgccg tcttcggcac gctgatgtac      1260
     cggcgctacg tcaacgccat cgccgaggtc gaactggtca acgccagcct ggccgagcgc      1320
     ctgcaggcgc gcgaggccga gctcgaacag agccaccgcc ggctgcgcga ggtggaaaag      1380
     cgccagacca tcagcgacga gcgccagcgg ctgatgcagg acatgcacga cggcctgggc      1440
     tcatcgctca tcagcgcgat ccgttcggtg gagaacgggc gcctcagcga cgagaaggtg      1500
     tcgcatatcc tcagaagctg cctggacgac ctgaagctca ccatcgattc gatggagccg      1560
     ctcgaggaag acctgctgct cctgctggcc acgctgcgct accgcctcgg tccccggctc      1620
     gagggctccg gcgtcgcgct gcgctgggag gtgcaggaga tcccgccgct cgactggctc      1680
     gacccgacca gcgcgctgca catcctgcgc atcgtgcagg agagcatcgc caacatcctg      1740
     cgccacacgc gcgccaccga aatccgcgtg ggcaccgcgc ccgaggccga gggcgtgcgg      1800
     gtgaccatcg aggacaacgg ccagggcttc gacgtcgaca aggcgatggc cgaggccggc      1860
     gggcgcggca tgcagaacca gttgcgccgt gcgcaggcca tcggcggggg cgtgagctgg      1920
     cgctcggggc cgacgggcac gctgttcacg ctgtggctgc cgctgcagcg caagccgcgg      1980
     aaggcttga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page