(data stored in SCRATCH zone)

EMBL: CP002417.PE399

CP002417.PE399       Location/Qualifiers
FT   CDS_pept        complement(429489..429917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0400"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: vap:Vapar_0381 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34622"
FT                   /db_xref="GOA:E6V3D2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D2"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADU34622.1"
FT                   /translation="MTSPGTTTVRSLAGKCLCGAVHYTVADEFTYALNCHCADCRRATG
FT                   SAFKPFAGIERHKLAITQGADTLLIHGEEDAGDIHCGKCGSFLYSVVRDGMFVHVTLGT
FT                   LVDDPSIRPSAHIFVGSKAPWFAINDDLPQHQGHAGAD"
     gtgacaagcc ccgggacaac caccgtccgc agcctcgccg gcaagtgcct gtgcggggcc        60
     gtccactaca cggtggccga cgaattcacc tacgccctga attgccactg cgcggactgc       120
     cggcgcgcga cgggctcggc cttcaagccc tttgccggca tcgagcggca caagctggcg       180
     atcacgcagg gcgccgacac gctgctgatc cacggcgaag aagacgccgg cgacatccac       240
     tgcggcaagt gcggctcgtt cctgtattcg gtggtgcgcg atggcatgtt cgtgcacgtc       300
     accctgggca cgctggtcga cgatccgtcc atccgaccca gcgcacacat cttcgtcggc       360
     tcgaaggccc cctggttcgc catcaacgac gacctgccgc agcaccaagg gcacgcgggc       420
     gccgactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page