(data stored in ACNUC1104 zone)

EMBL: CP002417.PE4

CP002417.PE4         Location/Qualifiers
FT   CDS_pept        complement(6085..6729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34227"
FT                   /db_xref="GOA:E6UXN3"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN3"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0003"
FT                   /protein_id="ADU34227.1"
FT                   /translation="MNGTDDHDPLPERREAMTAWERGLRPKRDRHWALWLALAALLVFL
FT                   LFRGAEWLLAQRASSQPAQQRPTAPPAPIGRAAPVPPSPSLAPAPPDTFEVTKCLTPSG
FT                   KAAYSDGPCPPGSRATTVRLRRDVNIADGMSISEREASNRNNTAVAEQQQQYERQVARN
FT                   VDSAMAECSQLDESVKRLDAAARQPQDVYSQDRLRSERHAARDRRFRLGCQ"
     atgaacggca ccgacgacca cgaccccctg cccgaacgcc gagaggcgat gacggcatgg        60
     gagcgtggtt tgaggccgaa gcgggatcgc cattgggcgt tgtggctggc gctcgccgcg       120
     ttgctcgtgt tcctgctctt tcggggcgcg gaatggttgc tggcgcagcg cgcttcttcc       180
     cagcctgcgc aacagcgccc gacagcgcca cctgcgccga tcggccgtgc tgcgcccgtg       240
     ccgccgtcgc catctctcgc ccccgcccca cccgacactt tcgaggtgac caagtgcctc       300
     acgccctcgg gcaaggctgc ttattcggac gggccctgtc cgccgggctc acgcgccacg       360
     acggttcgcc tccgtcgcga cgtgaacatt gcggatggaa tgagcatctc ggaacgagag       420
     gcttcgaacc gaaacaacac cgctgtcgcc gagcagcaac agcaatacga gcggcaggtg       480
     gctcgcaatg tcgacagcgc gatggctgaa tgcagccagc tggatgaatc cgtcaaacgg       540
     ctcgatgccg ccgcacggca gccgcaggac gtgtattcgc aggatcggct gcgcagcgaa       600
     agacatgcag cgcgcgacag gcggttccgg ttgggttgcc agtag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page