(data stored in ACNUC1104 zone)

EMBL: CP002417.PE402

CP002417.PE402       Location/Qualifiers
FT   CDS_pept        431653..432432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0403"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dac:Daci_4599 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34625"
FT                   /db_xref="GOA:E6V3D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34625.1"
FT                   /translation="MGYSGDPLPQPTPTDPLVPYSIRLESVTLVRGEQRVFDELTLSLD
FT                   EARIGLVGDNGAGKSSLFRLISGLDQPQQGRVVVHGCDTQGTQADRRQLSQHVGLMFQN
FT                   PDDQIIFPTVAEELAFSLTARGETRQAARERAREFLAERGLAAWAGRAIGELSQGQRQQ
FT                   VCLLALQIGQPATLLLDEPFASLDLLSQARLAAQLEATGQQIVVSTHLLEHVYDFERVL
FT                   WLEQGRVRADGPGREVCEAYAENVRQRAEAERGPRHA"
     ttggggtaca gtggcgaccc cttgccgcag ccgaccccta ccgaccccct cgtcccgtac        60
     agcatccgcc tcgaatcggt cacgctggtt cgcggcgaac agcgcgtttt cgacgagctg       120
     acgctcagcc tcgacgaagc gcgcatcggc ctcgtcggcg acaacggcgc gggcaagagc       180
     agcctgtttc gcctcatcag cgggctcgac cagccgcagc aagggcgcgt cgtggtgcat       240
     ggctgcgaca cgcaggggac gcaggccgac cgccgccagc tctcgcagca cgtggggctg       300
     atgttccaga accccgacga ccagatcatc tttcccaccg tggccgagga gctcgcgttc       360
     agcctcacgg cgcgcggcga aacgcggcag gcggcgcgcg agcgggcgcg cgaattcctg       420
     gccgaacgcg ggctcgcggc gtgggccggg cgcgcgatcg gcgaactgag ccaggggcag       480
     cggcagcagg tgtgcctgct ggcgctgcag atcggccaac ccgccacgct gctgctcgac       540
     gagccctttg caagcctcga cctcttgagc caggcgcggc tcgcggcgca gctcgaagcg       600
     acgggccagc agatcgtcgt ctccacgcac ctgctcgaac atgtgtacga cttcgagcgc       660
     gtgctgtggc tcgaacaagg ccgggtgcgt gccgatggcc cggggcgcga agtctgcgag       720
     gcctatgccg agaacgtgcg ccagcgcgcc gaggccgagc ggggcccacg ccatgcgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page