(data stored in ACNUC1104 zone)

EMBL: CP002417.PE403

CP002417.PE403       Location/Qualifiers
FT   CDS_pept        432425..433018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0404"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   ctt:CtCNB1_2059 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34626"
FT                   /db_xref="GOA:E6V3D6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADU34626.1"
FT                   /translation="MRSLYSSHPTWTHALPAWVKLAVLSVCGTLLVLVERPVHLGIACV
FT                   VVLLLFASLGRTAWLRVRMLAGIAIGCALIVGFHWFLGTTVLGVASALRLASAAVLALM
FT                   LTLTTRFEDLLAVLETVMRPLQRFGVPTERIALGIGLMLRFAENFYVQWQRLDDAYRAR
FT                   AGHGGGLRLLAPLTIRTLQTAERVADALAARLGR"
     atgcgtagcc tctactcgtc gcatccgacc tggacgcatg cgctgccggc gtgggtcaag        60
     ctcgcggtgc tttcggtgtg cggcacgctg ctggtgctgg tcgagcggcc ggttcacctg       120
     ggcatcgcct gcgtcgtcgt gttgctgctc ttcgcatcgc tcggccgcac ggcgtggctg       180
     cgcgtgcgga tgctggcggg catcgcgatc ggctgcgcgc tgatcgtcgg ctttcactgg       240
     ttcctgggca cgactgtgct cggcgtggcg agcgcgctgc ggctcgcgag cgcggccgtg       300
     ctcgcgctga tgctgacgct caccacgcgc ttcgaagacc tgctggccgt gctcgaaacc       360
     gtgatgcggc cgctgcagcg tttcggcgtg ccgaccgagc ggatcgcgct cggcatcggc       420
     ctgatgctgc gctttgccga gaacttctac gtgcagtggc agcgcctgga cgacgcctac       480
     cgcgcccgcg ccgggcatgg cggcgggctg cgcctcctgg cgccgctgac catccgcacg       540
     ctgcagaccg ccgagcgggt ggccgatgcg ctggccgcgc ggctgggccg atag             594
//

If you have problems or comments...

PBIL Back to PBIL home page