(data stored in ACNUC1104 zone)

EMBL: CP002417.PE404

CP002417.PE404       Location/Qualifiers
FT   CDS_pept        433064..433642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0405"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ajs:Ajs_2319 BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34627"
FT                   /db_xref="GOA:E6V3D7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D7"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADU34627.1"
FT                   /translation="MTTTGSITSSRSLSYIALFAALMAVFGLIPKVDLPFGVPITLQSL
FT                   GVMLAGCLLGPRRGFFAIALFLLAVALGLPLLPGGRGGLAVFVAPAGGFLFGWMFGAFA
FT                   CGLLMRRMAGATGKGLLAAAFLSSVVGGIVVVYAFGIVGLSLIAHMSLTQAALAMLVFI
FT                   PGDLIKCGICAMLVQTVMRGMPSWRLDRD"
     atgaccacca ccggctccat cacctcgtcc cgttcgctct cgtacatcgc gctgttcgcc        60
     gcgctgatgg cggtgttcgg cctgattccc aaggtcgacc tgccgttcgg cgtgccgatc       120
     acgctgcagt cgctgggcgt gatgctggcc ggctgcctgc tcgggcctcg gcgcggcttc       180
     ttcgcgattg cgctgttcct gctggcggtg gcgctcgggc tgccgctgct gccgggcggg       240
     cgcggcgggc tggcggtgtt cgtcgcgccg gccggcggct tcctgttcgg ctggatgttc       300
     ggcgcctttg cttgcgggct gctgatgcgc cgcatggccg gcgcgaccgg caaggggctg       360
     ctggccgcgg cgttcctgtc gtcggtggtc ggcgggatcg tcgtggtcta tgccttcggc       420
     atcgtcgggc tctcgctgat cgcccacatg tcgctcacgc aggcggcgct ggcgatgctg       480
     gtgttcattc ccggcgacct catcaagtgc ggcatctgcg cgatgctcgt gcagacggtg       540
     atgcgcggca tgccgagctg gcggctcgac cgcgactga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page