(data stored in ACNUC1104 zone)

EMBL: CP002417.PE407

CP002417.PE407       Location/Qualifiers
FT   CDS_pept        complement(434841..435875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_1752 DNA polymerase III, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34630"
FT                   /db_xref="GOA:E6V3E0"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E0"
FT                   /inference="similar to AA sequence:KEGG:Gbro_1752"
FT                   /protein_id="ADU34630.1"
FT                   /translation="MLVASSMARLHPSVARIAHLSGHTPGYGYVSPDGRYQAVEAGGDT
FT                   LIVDLQARRMHRAPGVYPRGFEEAAPDGATGTTLRVEGEETATAYLPAWTDLQWIALEN
FT                   TAEDFWTPWPDPPDRRSADLPTVDETLPAEWTSDAPQATERVRRSVGDWVAWFVALAVL
FT                   AFFAVFGVRAMTWALAGGWQWLWMAVGLPVFAMFSVLTVVFVATTLRERRRVRVALSGM
FT                   SLERGEGFRVGEPLDVRLLATVPDAHAGERTVAPERIAVRLMRRSIRSETDGRWSVMDE
FT                   CRDEAVALRDDLTRAGRVLYACELCARPAPDDASAQWFVTLHEAAAPDSAPFVVAGLRL
FT                   LPAR"
     atgctcgtcg cctcctccat ggcccgcctt catccgtccg tcgcacgcat cgcccatctt        60
     tccggacaca cgccgggcta cgggtatgtc tcgcccgacg gccgctacca ggcggtggag       120
     gccggcggcg acacgctgat cgtcgacctg caggcgcggc ggatgcaccg ggcgcccggc       180
     gtgtacccgc gcggcttcga ggaggcggcg cccgatggcg cgacaggcac cacgctgcgg       240
     gtggaaggcg aggaaaccgc cacggcctac ctgccggcct ggacggatct ccaatggatc       300
     gcgctggaga acacggcgga agatttctgg acgccatggc ccgatccacc cgatcgacga       360
     tcagccgact tgccaacggt cgatgaaacg ctccctgccg aatggacctc cgatgcaccg       420
     caagccacgg aacgcgtgcg cagatccgtc ggcgactggg tggcctggtt cgtcgcgctg       480
     gcggtgctgg ccttcttcgc ggtcttcggc gtcagggcaa tgacctgggc gctggccggc       540
     ggttggcaat ggctctggat ggcggtcggc ttgccggtgt tcgcgatgtt ctcggtgctg       600
     acggtggtct tcgtcgccac gaccttgcgc gagcggcgcc gtgtgcgcgt ggccttgagc       660
     ggcatgtcgc tggagcgcgg ggaaggcttt cgcgtcggcg agccgctcga cgtgcgtctg       720
     ctggcaaccg tgcccgacgc gcatgcaggc gagcgcacgg tggcgccgga gcgcattgcc       780
     gtgcggctga tgcggcggtc gatccgcagc gaaaccgacg gccgctggag cgtgatggac       840
     gaatgccgcg acgaagcggt tgccctgcga gacgacttga cccgcgccgg ccgggtgctc       900
     tatgcgtgcg agctttgcgc gcgccccgct cccgacgacg cgtcggcgca gtggttcgtc       960
     acgctgcacg aagcggccgc gccggacagc gcgcccttcg tcgtcgccgg cctgcggctg      1020
     ctgcccgcgc gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page