(data stored in ACNUC1104 zone)

EMBL: CP002417.PE409

CP002417.PE409       Location/Qualifiers
FT   CDS_pept        436732..438597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0410"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; glycosyl transferase
FT                   group 1; KEGG: mxa:MXAN_4997 VanW-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34632"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E2"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ADU34632.1"
FT                   /translation="MAQARPVGVSVRAWQPPRRIDAIDFWLRSRLLASAHALREALRPS
FT                   ARRWHGDAHALADAPVLAQYRTPLWSDGRADEFPLVAGKVQNLRVARRAFDAIEVPAGE
FT                   VLSFWRQLGRPSASRGFVQGRELRGGCVVPTLAGGLCQLSNALATVAARAGLELVERHG
FT                   HTARIEQAADAAGDAVDATVFWNYVDLKVRAKHAWRLEVELTSDELVLRIRARSPIAMP
FT                   AVPMALRRASEEGASAALPLARGCLSCDQTACFRHRLLPAVAQQGRTAVLLDAWTPEFA
FT                   RYLAAHHTGADRMQPVPLRLAFWRAGPATGRHREAVADGAASVQSPWWASLRSTVWQRL
FT                   WARHAGRRQGSLIGGQRWLALAFAARLKPEHTQLVIDQALLPHLQQLGALDGRRVTVLA
FT                   SALPMAEIERRLDAAAQRWPGDATLRDFRADAALVQAEAAALARVAAVVTPHAEAATHL
FT                   AAMAPRAALFRLDWVLPAARDIDAACDAPPLIVFAASALARKGARELAAALQGWPCRLR
FT                   VLGSPSDDAQLWRGIGSVEHMHWRGDGLNGARVVVLPAHIEHAPRALLRALAAGVPVVA
FT                   SSACGLAGLSGVREVAAGDVEGLRAALKNACNADDGNNKNDESAS"
     atggcgcaag cgaggcccgt cggtgtgagc gtgcgggcct ggcagccgcc gcgccgcatc        60
     gacgccatcg atttctggct gcgctcccgg ctgctggcca gcgcccacgc gttgcgcgag       120
     gcgctgcggc cttcggcgcg gcgctggcac ggcgatgccc atgcattggc cgatgcgccg       180
     gtgctcgcgc agtaccgaac cccgctctgg tccgacggac gcgcggacga atttcccctc       240
     gtggccggca aggtgcagaa cctgcgcgtg gcgcgccgcg ccttcgatgc catcgaggtg       300
     cccgccgggg aggtgctgag tttctggcgc cagctgggcc ggccgagcgc ttcgcgcggc       360
     ttcgtgcagg gtcgcgaact gcgcggcggc tgcgtggtgc cgacgctggc cgggggcctg       420
     tgccaactct cgaatgcgct cgccaccgtg gcggcccgcg ccgggctcga actggtggag       480
     cgccacggac acaccgcgcg catcgaacag gccgccgatg ccgcgggcga tgccgtggat       540
     gcgacggtgt tctggaacta cgtcgatctg aaggtacgcg cgaagcatgc gtggcggctc       600
     gaggtcgagc tgacctccga tgagctggtg ctgcgcatcc gcgcgcgctc gccgatcgcg       660
     atgccggcgg tgccgatggc gctgcggcgg gcgagcgaag agggcgccag cgctgcgttg       720
     ccgctggcac gcggctgtct gagctgcgac cagacggcct gcttccggca ccgcctgctc       780
     cctgctgtgg cgcagcaagg acgcacggcc gtcctgctcg acgcgtggac gcccgagttc       840
     gcgcgctatc tcgccgcaca ccacaccggc gccgaccgca tgcagccggt gccgctgcgg       900
     ctcgcgttct ggcgcgccgg gccggccacg ggccggcacc gggaagccgt cgcggatggc       960
     gccgcatccg tccagtcgcc gtggtgggcc agcctgcgca gcaccgtgtg gcagcggctc      1020
     tgggcgcggc atgcgggccg gcggcagggc agcctgatcg gcggtcagcg ttggctggcg      1080
     cttgccttcg ccgcacgcct gaagcccgag cacacgcaac tcgtgatcga ccaggcgctg      1140
     ttgccgcatc tgcagcaact cggcgcgctc gacggtcgcc gcgtcacggt gctggccagc      1200
     gccttgccga tggcggagat cgaacgccgg ctcgatgcgg ccgcgcagcg ctggcccggt      1260
     gacgccacgc tgcgcgactt tcgtgcggat gccgcgctcg tgcaggcgga ggccgcggcg      1320
     ttggcgcggg ttgcagcggt ggtcacgccg catgccgaag ccgcaacgca tctggctgcg      1380
     atggcgccgc gggcggcatt gtttcggctc gattgggtgc tgcctgccgc gcgcgacatc      1440
     gatgccgcat gcgatgcgcc gccgctgata gtgttcgccg caagcgcgct cgcgcgaaag      1500
     ggcgcgcgcg aactggccgc ggcgctgcaa ggctggccct gccgcctgcg cgtgctcgga      1560
     tcgccctcgg acgatgccca gctctggcgc ggcatcggca gcgtcgagca tatgcactgg      1620
     cggggcgacg ggctgaacgg cgcccgcgtg gtcgtgctgc ccgcgcacat cgagcacgca      1680
     ccgcgcgcgc tgctgcgcgc cctggcagcc ggcgtgccgg tggtggcatc gagcgcttgc      1740
     ggcctcgccg gactgtccgg cgtgcgcgaa gtggcagcgg gcgatgtgga gggtctgcgt      1800
     gcggcattga agaacgcgtg caacgcggac gacggcaaca acaagaacga cgaaagcgct      1860
     tcatga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page