(data stored in SCRATCH zone)

EMBL: CP002417.PE416

CP002417.PE416       Location/Qualifiers
FT   CDS_pept        444619..445749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0417"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: vap:Vapar_6044 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: alanine dehydrogenase/PNT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34639"
FT                   /db_xref="GOA:E6V3E9"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E9"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADU34639.1"
FT                   /translation="MLIGVPAETAAGETRVAVTPETVKKLVASGHIVRVQSGAGVAASV
FT                   TDAAYQTAGAEITDQAGALSADMVLKVRTPSDAEAGLMKPGAVVIGMLNPFDAAGLQRL
FT                   ASAGVTGFALEAAPRTTRAQSMDVLSSQANIAGYKAVMIAADRYQRFFPMLMTAAGTVK
FT                   AARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQIESLGGKFIEVSYDTDEEKE
FT                   AAVGVGGYAKPMPPSWLARQQVEVAKRVALADIVISTALIPGRAAPTLITEDMVKSMKP
FT                   GSVIVDIAAGKGADGVGGNCPLSEADKTVVKHGVTIVGETNLAALVAADASALYARNVL
FT                   DFLKLIVTKEGALKIDLEDDIVAACRMTQDGQVTKK"
     atgctgatag gcgtgcctgc cgaaaccgcg gctggcgaaa cccgagtggc cgtgacacct        60
     gaaacggtga agaaactggt cgcttccggg catatcgttc gtgttcagtc gggagcgggc       120
     gtcgcagcca gcgtcaccga tgcggcttac cagaccgccg gcgcggaaat cacggaccaa       180
     gcgggcgctc tgtccgccga catggtgctc aaggtgcgca cgcccagcga tgccgaggcg       240
     gggctgatga agcccggcgc cgtcgtcatc ggcatgctca accccttcga tgccgcgggc       300
     ctgcagcgcc tggcatcggc cggcgtgacc ggcttcgccc tcgaagccgc cccccgcacc       360
     acccgcgccc agagcatgga cgtgctctcc tcgcaagcca acatcgccgg ctacaaggcc       420
     gtgatgatcg cggccgaccg ctaccaacgc ttcttcccga tgctcatgac ggcagccggc       480
     acggtgaagg ccgcgcgcgt cgtcatcctg ggcgtcggcg ttgccggcct gcaggcgatc       540
     gccacggcca agcggctggg cgccgtcatc gaagcttccg acgttcgccc gagcgtcaag       600
     gagcagatcg aatcgctcgg cggcaagttc atcgaggtct cctacgacac cgatgaagaa       660
     aaggaagccg ccgtcggcgt cggtggctac gccaagccga tgcccccgag ctggctcgca       720
     cgccagcagg tcgaggtcgc caagcgcgtg gcactggccg acatcgtcat cagcaccgcg       780
     ctcattcccg gccgcgccgc gcccacgctc atcaccgagg acatggtcaa gtccatgaag       840
     cccggctcgg tgatcgtgga catcgccgcc ggcaaaggcg ccgatggcgt gggcggcaac       900
     tgccccctct ccgaagccga caagaccgtc gtcaagcacg gcgtgaccat cgtcggcgag       960
     accaacctcg cggcgctcgt ggcggccgac gcatcggcgc tctatgcgcg caacgtgctc      1020
     gacttcctca agctcatcgt cacgaaggaa ggtgcgctca agatcgacct cgaagacgac      1080
     atcgtcgccg cctgccgcat gacgcaagac ggccaggtca cgaagaaata a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page