(data stored in ACNUC1104 zone)

EMBL: CP002417.PE417

CP002417.PE417       Location/Qualifiers
FT   CDS_pept        445782..446114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0418"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: vap:Vapar_6043 NAD(P) transhydrogenase,
FT                   subunit alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34640"
FT                   /db_xref="GOA:E6V3F0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6043"
FT                   /protein_id="ADU34640.1"
FT                   /translation="MDPVSHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTTTPLGKTMGVLAVALAAVNVFGGFLVTRRMLEMFKKKDKKAAAPKA
FT                   EEGASK"
     atggatcccg tttcccacac agtcatcaac ctgatcatct tcgtgctggc catctacgtc        60
     ggctaccacg tggtctggac cgtcactccc gcgctgcaca cgccgctgat ggccgtgacc       120
     aacgcgatct cggcgatcgt gatcgtgggc gccatgctgg cggccgcgct caccaccacg       180
     ccgctgggca agaccatggg cgtgctcgcg gtggccctgg ccgcggtgaa cgtcttcggc       240
     ggcttcctgg tcacgcggcg gatgctggag atgttcaaga agaaggacaa gaaagccgcc       300
     gcacccaagg ctgaagaggg agcttccaag tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page